SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protei...    33   0.011
DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protei...    33   0.011
AF043439-1|AAC05664.1|  239|Anopheles gambiae putative pupal-spe...    27   0.75 
AF043433-2|AAC05657.1|  239|Anopheles gambiae putative pupal-spe...    27   0.75 
AF043441-1|AAC05666.1|  231|Anopheles gambiae putative pupal-spe...    26   1.3  
AF043437-1|AAC05662.1|  239|Anopheles gambiae putative pupal-spe...    26   1.3  
AY255856-1|AAP13482.1|  248|Anopheles gambiae glutathione transf...    24   4.0  
AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        23   9.2  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    23   9.2  

>DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 32.7 bits (71), Expect = 0.011
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204



 Score = 30.7 bits (66), Expect = 0.046
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205


>DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 32.7 bits (71), Expect = 0.011
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C +G  C F+H+  +
Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSD 204



 Score = 30.7 bits (66), Expect = 0.046
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 176 YQPDICKDYKETGYCGFGDSCKFLHDRSDY 205


>AF043439-1|AAC05664.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 26.6 bits (56), Expect = 0.75
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240
           HH   GS ATSH ++Q  A PT+   G +
Sbjct: 24  HH---GSIATSHSTIQHHAAPTIQHVGSV 49


>AF043433-2|AAC05657.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 239

 Score = 26.6 bits (56), Expect = 0.75
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240
           HH   GS ATSH ++Q  A PT+   G +
Sbjct: 24  HH---GSIATSHSTIQHHAAPTIQHVGSV 49


>AF043441-1|AAC05666.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 231

 Score = 25.8 bits (54), Expect = 1.3
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 169 GSSATSHKSLQDRALPTV*RSGGL 240
           GS ATSH S+Q  A P +   G +
Sbjct: 26  GSIATSHSSIQHHAAPAIHHVGSI 49


>AF043437-1|AAC05662.1|  239|Anopheles gambiae putative
           pupal-specific cuticular proteinCP2b protein.
          Length = 239

 Score = 25.8 bits (54), Expect = 1.3
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +1

Query: 154 HHQ*TGSSATSHKSLQDRALPTV*RSGGL 240
           HH   GS ATSH S+Q  A P +   G +
Sbjct: 24  HH---GSIATSHSSIQHHAAPAIHHVGSV 49


>AY255856-1|AAP13482.1|  248|Anopheles gambiae glutathione
           transferase o1 protein.
          Length = 248

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 337 HSVGFCPYGPRCHFVHNAEE 396
           +S+ FCPY  R H + +A++
Sbjct: 25  YSMRFCPYAQRVHLMLDAKK 44


>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +1

Query: 265 AHGVRELRNLQRHPKYKTELCRT 333
           +HG R L + QR   YK EL  T
Sbjct: 233 SHGDRLLEDRQRFDNYKRELKET 255


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +3

Query: 486  AIATLAAFPLTPHSPPAMSPP 548
            AIA LA   + PH+PP  + P
Sbjct: 1257 AIAGLAQGSMGPHTPPPPNTP 1277


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 698,222
Number of Sequences: 2352
Number of extensions: 14196
Number of successful extensions: 81
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 74
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 81
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71086350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).