SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ697720-1|CAG26913.1|  207|Anopheles gambiae putative odorant-b...    27   0.46 
L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase pro...    24   4.3  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    24   4.3  
AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase p...    24   4.3  
AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic acetylch...    23   5.7  
AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic acetylch...    23   5.7  
AF457565-1|AAL68795.1|  391|Anopheles gambiae TRIO protein protein.    23   5.7  

>AJ697720-1|CAG26913.1|  207|Anopheles gambiae putative
           odorant-binding protein OBPjj10 protein.
          Length = 207

 Score = 27.1 bits (57), Expect = 0.46
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = -3

Query: 425 LTEEFFGFTFIKFQPCFLD 369
           L++EFFG   + F  CFLD
Sbjct: 111 LSKEFFGLVMVCFVKCFLD 129


>L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +3

Query: 450 ISLDEFLIKIRPPMSESRRK 509
           I LD+FL+ +RP  +  RR+
Sbjct: 526 IELDKFLVALRPGANRIRRR 545


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
            channel alpha1 subunit protein.
          Length = 1893

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +1

Query: 355  NSFMASRKQGWNLIKVKPKNSSVNSTQTV--VAQSVL 459
            ++ ++    G +  ++KPK + VNS+ T   VA+S+L
Sbjct: 1682 HTVLSGPNDGSSQTEMKPKQNCVNSSNTYNHVAESIL 1718


>AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +3

Query: 450 ISLDEFLIKIRPPMSESRRK 509
           I LD+FL+ +RP  +  RR+
Sbjct: 526 IELDKFLVALRPGANRIRRR 545


>AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +3

Query: 444 GSISLDEFLIKIRPPMSESRRKL*NK 521
           G   L  FL   RPP  E+ RKL +K
Sbjct: 350 GKDFLPRFLFMKRPPYIENHRKLLSK 375


>AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +3

Query: 444 GSISLDEFLIKIRPPMSESRRKL*NK 521
           G   L  FL   RPP  E+ RKL +K
Sbjct: 350 GKDFLPRFLFMKRPPYIENHRKLLSK 375


>AF457565-1|AAL68795.1|  391|Anopheles gambiae TRIO protein protein.
          Length = 391

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +1

Query: 124 KVKAEMESSVAWHRPMSAGSVQEEELMQKSARAMTQATDPLEKLA 258
           K+ A M +      PM A   + EE +++      +A +PL+K A
Sbjct: 103 KIDAAMANFKTLFEPMKADLAKLEEEVKRQVLDAWKALEPLQKEA 147


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 561,509
Number of Sequences: 2352
Number of extensions: 10502
Number of successful extensions: 17
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).