BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0245.Seq (906 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 26 1.4 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 5.5 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 475 PPGFPQS--RRCKTTASEIVIRLTIGRIGYXAPPREWR 368 P G P + +RC+TT + I+ +L + P+ WR Sbjct: 561 PDGIPSTVLKRCQTTVAPILAKLFNASLANGYFPKAWR 598 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 5.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 465 NPGGTXLNRLAAHPPXPAGRNS 530 +PG +L+ HPP +GR+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,869 Number of Sequences: 2352 Number of extensions: 13272 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -