BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0240.Seq (910 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 27 1.0 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 26 1.4 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 26 1.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 4.2 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 4.2 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.6 bits (56), Expect = 1.0 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 496 ISILRTSIVFLPIVSRVPRPPDMTLVPVVSTNLV 597 ISIL + +VFL +VS++ PP ++P+++ L+ Sbjct: 268 ISILLSLVVFLLLVSKI-LPPTSLVLPLIAKYLL 300 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 26.2 bits (55), Expect = 1.4 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 747 PSYFLVFL--PLVADASATRLLSQPCSLGLVRVCLNVCDDTV 628 P Y+ +FL P+ ADAS +L LV+ VC DTV Sbjct: 57 PHYWELFLAHPIDADASHCSILENEVVFELVKQDPTVCWDTV 98 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 26.2 bits (55), Expect = 1.4 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 747 PSYFLVFL--PLVADASATRLLSQPCSLGLVRVCLNVCDDTV 628 P Y+ +FL P+ ADAS +L LV+ VC DTV Sbjct: 57 PHYWELFLAHPIDADASHCSILENEVVFELVKQDPTVCWDTV 98 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 4.2 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 573 ASSFNKFSHF*DKTSKW--KRLYHRRRSNKHALVRD 674 A SFNK SHF + +W RL R + A RD Sbjct: 358 AKSFNKMSHF-NSLKQWGMNRLRMMNRDSSSASQRD 392 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.6 bits (51), Expect = 4.2 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 573 ASSFNKFSHF*DKTSKW--KRLYHRRRSNKHALVRD 674 A SFNK SHF + +W RL R + A RD Sbjct: 359 AKSFNKMSHF-NSLKQWGMNRLRMMNRDSSSASQRD 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,143 Number of Sequences: 2352 Number of extensions: 11851 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98401338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -