BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 25 3.2 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 25 3.2 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 24 7.3 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 9.6 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 9.6 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -1 Query: 295 NAVTPVIRFYKGMPQVVLSSHSSR 224 +A V+R+YK MP+++ +S ++R Sbjct: 178 SAYVNVLRWYKSMPELIPASDTNR 201 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 25.0 bits (52), Expect = 3.2 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -1 Query: 295 NAVTPVIRFYKGMPQVVLSSHSSR 224 +A V+R+YK MP+++ +S ++R Sbjct: 178 SAYVNVLRWYKSMPELIPASDTNR 201 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.8 bits (49), Expect = 7.3 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 522 FYQAQGFHIVDCAWQDETQLPTWIM 596 +Y FH V + +E+ L WI+ Sbjct: 237 YYAQPKFHAVQLPYSEESDLTMWIL 261 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.4 bits (48), Expect = 9.6 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +3 Query: 261 PL*KRITGVTAFRWCGMPILPTRKTGSGKKTVSFSVLSALWKADFWQRCL 410 PL + + RW + T SGK + FS ++A+ A+ + RC+ Sbjct: 111 PLSHHLVAMEGTRWKNLRAKLTPTFTSGKMKLMFSTVTAV--AEEFDRCM 158 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 9.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 368 FVSIMEGRFLAAMFVAPKAVRAVLVRR*CSM 460 +VS +EG ++ +A K VRAV C + Sbjct: 207 YVSTLEGNMISIGKLAEKGVRAVFDNTGCKL 237 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,064,278 Number of Sequences: 2352 Number of extensions: 23826 Number of successful extensions: 63 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -