BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0236.Seq (900 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 27 1.0 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 23 9.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.6 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 9.6 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 26.6 bits (56), Expect = 1.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 37 ACKAEEELPERCKAFGRVSFTADFICHSRRGY*D 138 AC + E P++C + S++++ + SR GY D Sbjct: 751 ACDCKMECPKQCTCYHDQSWSSNVVDCSRAGYDD 784 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.4 bits (48), Expect = 9.6 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -3 Query: 688 TICHSPFQVRNCWEGRSVRASSLLRQL 608 T+C F + CW+ + + LR++ Sbjct: 121 TLCDKAFWLHKCWKQSDPKVNMALRRI 147 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 558 NPGVTQLNRLAAHPPFASWRNS 623 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 9.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 178 NDYVLNGVDTSIRDLNNLVESD 113 ND V + +DT++ D N+L E+D Sbjct: 267 NDLVTSIIDTALVDDNSLQETD 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 831,239 Number of Sequences: 2352 Number of extensions: 15826 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -