BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0235.Seq (823 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 6.5 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 8.6 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 348 IHWPVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 452 +H Q +PG +L+ HPP AS R+S Sbjct: 822 LHHHAAQQPPPGSHPGAQTQPQLSQHPPGASGRSS 856 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 543 REF*QNINAYNFHSPFXCATVGKGDRCGPLRYYAS 439 +E+ + N YNFH+ +G+ + P YAS Sbjct: 2633 QEWDEETNLYNFHARLYDPELGRFLQLDPKEQYAS 2667 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 543 REF*QNINAYNFHSPFXCATVGKGDRCGPLRYYAS 439 +E+ + N YNFH+ +G+ + P YAS Sbjct: 2634 QEWDEETNLYNFHARLYDPELGRFLQLDPKEQYAS 2668 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 782 ALRNWTPKTLIRVMXSRSGPS 720 A + WT TL+R+M +++GPS Sbjct: 733 ATKLWT--TLVRMMPNKAGPS 751 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 853,532 Number of Sequences: 2352 Number of extensions: 17568 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -