BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0231.Seq (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 27 0.73 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 25 2.2 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 2.2 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 2.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 2.9 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 25 2.9 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 24 5.1 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 24 5.1 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 24 5.1 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 24 5.1 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 6.8 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 26.6 bits (56), Expect = 0.73 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 103 APSSTVEMNPVIPGVEDEMVKKDAVFFNCE 14 APSST+E+ ++ V DE+ + + + CE Sbjct: 377 APSSTMEITVIVTDVNDEIPRFRSDGYECE 406 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 488 CKCRFG--RSXRERCTPSSMCR 547 C CR G R+ RC PS MC+ Sbjct: 97 CFCRGGYVRNKSNRCVPSYMCQ 118 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +2 Query: 11 FLAVKEHRILFDHLILHSRNYRVHLHGRGGSNQCVVPERPGSVLMEQQGSGNIISE 178 FLAV+EH ++ + S + + +HG V P P +V +G + S+ Sbjct: 179 FLAVEEHEQPYELTVEASSDRGLSVHGPTELGVLVRPMHPPNVTCAWDHAGELASD 234 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +2 Query: 11 FLAVKEHRILFDHLILHSRNYRVHLHGRGGSNQCVVPERPGSVLMEQQGSGNIISE 178 FLAV+EH ++ + S + + +HG V P P +V +G + S+ Sbjct: 179 FLAVEEHEQPYELTVEASSDRGLSVHGPTELGVLVRPMHPPNVTCAWDHAGELASD 234 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 172 DDVATTLLLHQYGAWSFWDYTLVAPSSTVEMN 77 D++ T + HQ +W+ W Y +A V +N Sbjct: 3276 DEMKTQINTHQQLSWAQWTYEDLAEDVEVYLN 3307 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 2.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 160 WQHHQRGLRSIWIRQERIQSFVLPCQSSLAVLFQIVEIDKTFFCFCY 300 W + G +IW+ IQ V S+ F I E++ FFC CY Sbjct: 45 WVADKTGNAAIWVTGT-IQRVV----SNTFEGFCIAEVNGVFFCSCY 86 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = -2 Query: 178 LADDVATTLLL---HQYGAWSFW 119 +ADD+ L + HQ+ AW+ W Sbjct: 102 IADDMRCALFIYRRHQFNAWNAW 124 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 295 RNKRRFYRSQQFGTKLQ 245 R +R YRSQ+FG ++Q Sbjct: 36 RRRRERYRSQRFGYEIQ 52 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 295 RNKRRFYRSQQFGTKLQ 245 R +R YRSQ+FG ++Q Sbjct: 36 RRRRERYRSQRFGYEIQ 52 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 295 RNKRRFYRSQQFGTKLQ 245 R +R YRSQ+FG ++Q Sbjct: 36 RRRRERYRSQRFGYEIQ 52 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +3 Query: 435 IFRRSSYGAAYYTLRFRSVNVALAGVYESAVHLVACVGRTSLTM 566 +FR S G Y L +++ L Y + A +GR + M Sbjct: 51 LFRGFSKGGCYDGLNLIELHIRLRQEYGDIYRIPAAMGRADVVM 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,495 Number of Sequences: 2352 Number of extensions: 12556 Number of successful extensions: 34 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -