BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0226.Seq (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 3.2 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 24 5.7 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 24 5.7 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 24 5.7 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 7.5 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 7.5 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 7.5 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 7.5 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 9.9 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 205 AHRRYAPQTCQYHRGCVTDSAAHKCNYELFNRNNF 309 A+R Y + CQ R D+ + C+Y F + Sbjct: 421 AYRHYQTRRCQRSRSIYFDTHSLYCSYNRFRYRRY 455 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 465 HLKDASPFLQERAVK 479 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 611 HLKDASPVLTMRSAK 655 HLKDASP L R+ K Sbjct: 449 HLKDASPFLQERAVK 463 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 538 SIPEREPEKRYHIQGRQQARKLPTPGTGR 452 S+P P + G Q R P P TGR Sbjct: 433 SVPRPLPSQEASPSGEQPGRMGPPPPTGR 461 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 226 QTCQYHRGCVTDSAAHKCNYELFNRNN 306 + Q R CV S A+ Y +++RNN Sbjct: 339 KVAQAQRQCVFASEANLSYYSVYSRNN 365 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 226 QTCQYHRGCVTDSAAHKCNYELFNRNN 306 + Q R CV S A+ Y +++RNN Sbjct: 339 KVAQAQRQCVFASEANLSYYSVYSRNN 365 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.4 bits (48), Expect = 7.5 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 481 APAAFLGCGTVSQAPSPESNPDSPLXVTTMVVAETXIE 594 AP AF V AP P + D P VT E+ +E Sbjct: 288 APLAFKVPLDVLPAPFPGPSTDEPRTVTRKRTTESDVE 325 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 492 LPWMWYRFSGSLSG 533 LPWMW GS+ G Sbjct: 287 LPWMWSILLGSIVG 300 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,588 Number of Sequences: 2352 Number of extensions: 15811 Number of successful extensions: 34 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -