BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0207.Seq (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.2 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 8.7 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 8.7 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 8.7 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 100 LNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNR 222 +++ + + ++L +I +D DS+ CN E FN+ Sbjct: 620 ISKELTKASIIQEILNIPTTIASDVAFDSSDFPCNSEEFNK 660 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 531 HLKDASPVLDHAICKSY 581 HLKDASP L K++ Sbjct: 449 HLKDASPFLQERAVKNF 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,641 Number of Sequences: 2352 Number of extensions: 14708 Number of successful extensions: 61 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -