SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0127
         (669 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         23   8.7  
AY146742-1|AAO12102.1|  154|Anopheles gambiae odorant-binding pr...    23   8.7  
AF437890-1|AAL84185.1|  154|Anopheles gambiae odorant binding pr...    23   8.7  

>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = +2

Query: 80   QDGHYQWTCLPFGLKTSPAIFQRILHNILRKYKLTDFTVNFIDD 211
            Q+G +QW  L FG   +  + +     I +  +  D +   ++D
Sbjct: 1185 QEGQFQWPMLSFGWNLADVLRKTKEQKIAQAQEAIDASAPEVED 1228


>AY146742-1|AAO12102.1|  154|Anopheles gambiae odorant-binding
           protein AgamOBP7 protein.
          Length = 154

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +1

Query: 547 DKCQEAFETVK 579
           DKC+ A+ETVK
Sbjct: 125 DKCETAYETVK 135


>AF437890-1|AAL84185.1|  154|Anopheles gambiae odorant binding
           protein protein.
          Length = 154

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +1

Query: 547 DKCQEAFETVK 579
           DKC+ A+ETVK
Sbjct: 125 DKCETAYETVK 135


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 683,597
Number of Sequences: 2352
Number of extensions: 13077
Number of successful extensions: 14
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 66904800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -