BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30113 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 29 0.19 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 3.2 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 28.7 bits (61), Expect = 0.19 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 149 TKIENGDHQNVAKLCLLMAVSKDFNDVLDDI 241 T+ EN D N+AK L+ + +FND DDI Sbjct: 211 TQFENADKPNLAK--LVETIKTNFNDRFDDI 239 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +2 Query: 383 TVNECLELNETSDAKLSEKIIAQLLKVKELIDTFPPNNSEDHDILGMAD 529 T N+C L D + + LLK+ E +D +E H+ +A+ Sbjct: 232 TENDCGLLEYLEDIVGTTRYKVPLLKINERVDALNEERTEKHNRCKLAE 280 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,223 Number of Sequences: 2352 Number of extensions: 11658 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -