BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D18 (920 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 32 0.028 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 1.8 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 7.5 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 7.5 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 31.9 bits (69), Expect = 0.028 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 456 PPPPKXGXPPTXPPXXPPXXXXGXXXGXXXXXXPPRPPXXXXXPPHXPXP 605 P P G PP PP G PPRP PP P P Sbjct: 178 PARPNPGMPPGPQMMRPPGNVGPPRTGTPTQPQPPRPGGMYPQPPGVPMP 227 Score = 29.1 bits (62), Expect = 0.20 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 435 PXXGGGXPPPPKXGXP--PTXPPXXPPXXXXGXXXGXXXXXXPPRPPXXXXXPPHXP 599 P GG P PP P P PP P G RPP PP P Sbjct: 212 PRPGGMYPQPPGVPMPMRPQMPPGAVPGMQPGMQPRPPSAQGMQRPPMMGQPPPIRP 268 Score = 25.0 bits (52), Expect = 3.2 Identities = 14/55 (25%), Positives = 15/55 (27%) Frame = +2 Query: 449 GXPPPPXXRGXPHTAPXXXPGXPXRGXPGXXXXXXPPAPXXXXXXPPXXPPXXXP 613 G PP P P G P + P P P P PP P Sbjct: 184 GMPPGPQMMRPPGNVGPPRTGTPTQPQPPRPGGMYPQPPGVPMPMRPQMPPGAVP 238 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 459 PPPKXGXPPTXPPXXPPXXXXGXXXGXXXXXXPPRP 566 PPP PP P PP G G PP P Sbjct: 581 PPP--APPPPPPMGPPPSPLAGGPLGGPAGSRPPLP 614 Score = 24.2 bits (50), Expect = 5.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 246 PXPXPXPPPPPG 281 P P P PPPP G Sbjct: 581 PPPAPPPPPPMG 592 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = -2 Query: 508 GGXXGGXVGGXPXXGGG--GXPPPXXG 434 G GG GG P GGG G P P G Sbjct: 201 GAGGGGSGGGAPGGGGGSSGGPGPGGG 227 Score = 25.4 bits (53), Expect = 2.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 446 PXXXGXXXXXHXPPGFXGVXGGXXPGGGG 360 P G P G G GG PGGGG Sbjct: 200 PGAGGGGSGGGAPGGGGGSSGGPGPGGGG 228 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 7.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 508 GGXXGGXVGGXPXXGGG 458 GG GG G P GGG Sbjct: 690 GGSGGGLASGSPYGGGG 706 Score = 23.4 bits (48), Expect = 9.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 464 GGGGPPPXXXG 432 GGGGPPP G Sbjct: 764 GGGGPPPDGSG 774 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 7.5 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 475 GXPPHXPPXXPRXTXXGXP 531 G PP PP PR G P Sbjct: 88 GIPPFRPPWHPRPPFGGRP 106 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,692 Number of Sequences: 2352 Number of extensions: 9873 Number of successful extensions: 55 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100055142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -