SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    23   6.5  
DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.        23   8.5  
DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.        23   8.5  
AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.      23   8.5  

>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = -2

Query: 487 RYFSSLPPVPGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 362
           RY   L  +  + NLR       +   LR    NRT  PRYP
Sbjct: 263 RYAQGLGRIEPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303


>DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 465 HLKDASPFLQERAVKNF 481


>AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.
          Length = 485

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSY 261
           HLKDASP L     K++
Sbjct: 449 HLKDASPFLQERAVKNF 465


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 688,661
Number of Sequences: 2352
Number of extensions: 15032
Number of successful extensions: 61
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 61
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).