SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative 5'-nucleo...    24   5.1  
AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P...    23   6.7  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            23   8.9  

>AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative
           5'-nucleotidase protein.
          Length = 570

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -1

Query: 298 RPSGRWCEATIRGIILNA 245
           R S RWCE T+  +I +A
Sbjct: 363 RESCRWCECTLGDLIADA 380


>AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P450
           reductase protein.
          Length = 679

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 5/37 (13%)
 Frame = -1

Query: 349 YCSVREEPQFRTFGSCTRPSGR-----WCEATIRGII 254
           YC   ++ +F  F S T P G+     W + + R I+
Sbjct: 395 YCGEEKDKEFLRFISSTAPDGKAKYQEWVQDSCRNIV 431


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = -1

Query: 193 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSM 86
           + R   GSK     S  + S+ E  RR+P    RSM
Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSM 141


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 706,819
Number of Sequences: 2352
Number of extensions: 13153
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).