SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    25   1.8  
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    23   4.2  
AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding pr...    22   9.8  

>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 24.6 bits (51), Expect = 1.8
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 5/53 (9%)
 Frame = +2

Query: 56  RTLDVRSGRMKL-SSYVRD----FRTPEAARFQSVNEGAL*AQMLGPERW*TM 199
           RT  V +G  ++  SY +D    + T E    +SV  G     +LGP  W TM
Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTM 640


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
            transcriptase protein.
          Length = 1049

 Score = 23.4 bits (48), Expect = 4.2
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
 Frame = -1

Query: 313  LLDGSISLSPLYPVPTIDLQSESLRS--SIRVSPDCDLTRHSSPSF 182
            LL+GSI  SPL     I   S +LRS  ++R++        S P F
Sbjct: 971  LLNGSIDSSPLLHRVDIYAPSRTLRSRETLRLAQPRSSAGRSDPMF 1016


>AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding
           protein AgamOBP15 protein.
          Length = 147

 Score = 22.2 bits (45), Expect = 9.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +3

Query: 150 KARSEHKCWDPKDGELCL 203
           +A S H+CW   + EL L
Sbjct: 122 RAYSHHRCWKETEPELRL 139


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 483,956
Number of Sequences: 2352
Number of extensions: 9033
Number of successful extensions: 20
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 43131618
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).