SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.           35   0.002
AF117750-1|AAD38336.1|  380|Anopheles gambiae serine protease 18...    26   0.82 
AY344828-1|AAR02439.1|  153|Anopheles gambiae peritrophin A prot...    23   4.4  
AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.           23   5.8  
AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.           23   5.8  
AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.           23   5.8  
AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.           23   5.8  
AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.           23   5.8  
AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.           23   5.8  
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            23   7.6  

>AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.
          Length = 897

 Score = 34.7 bits (76), Expect = 0.002
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 313 GLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWD 477
           GL DPF  I L+  ++  Y T +   +L+P W  H+ L +      DS+ + +++
Sbjct: 22  GLPDPFAKI-LVEGTTQEYTTEICKASLDPRWNSHYDLFLG---KNDSILITIYN 72


>AF117750-1|AAD38336.1|  380|Anopheles gambiae serine protease 18D
           protein.
          Length = 380

 Score = 25.8 bits (54), Expect = 0.82
 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 3/23 (13%)
 Frame = -1

Query: 183 CTY---DSIACCPTSQPTSHPPT 124
           C+Y   ++I CCP SQ    PP+
Sbjct: 50  CSYSATEAIVCCPQSQQLDSPPS 72


>AY344828-1|AAR02439.1|  153|Anopheles gambiae peritrophin A
           protein.
          Length = 153

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -3

Query: 445 SQCQTWVKKNVLPKQDLEFPTSPMCCTGVTSST 347
           SQC   +  N   KQ  ++P+   C  GVT +T
Sbjct: 54  SQCPPGLLWNDSQKQ-CDYPSQAQCAPGVTPNT 85


>AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 198 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 244


>AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 198 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 244


>AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 198 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 244


>AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 198 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 244


>AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 198 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 244


>AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.
          Length = 576

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/47 (25%), Positives = 20/47 (42%)
 Frame = +1

Query: 343 LMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           L+  +   Y+  V     +  W     LP    V++ +LCL   DF+
Sbjct: 425 LLKEADFHYDVFVSYSNADRSWVLDHLLPNMEGVSQINLCLHERDFE 471


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 22.6 bits (46), Expect = 7.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -3

Query: 322 R*DHSGL*ELNLWLRP 275
           R DH+ L E N+WL P
Sbjct: 894 RLDHNRLVEFNVWLLP 909


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 547,637
Number of Sequences: 2352
Number of extensions: 10390
Number of successful extensions: 21
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 44400195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).