SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    25   3.0  
AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subu...    24   4.0  
AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger transc...    24   4.0  
AY994096-1|AAX86009.1|   25|Anopheles gambiae 60s ribosomal prot...    23   7.0  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            23   9.2  

>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +3

Query: 591 SKRETRRRSPFGSRRSMLSVFFLTRASRLRSPDIT 695
           ++R+T+  SP GS  + ++   L+R S   SP+++
Sbjct: 178 ARRKTKPNSPLGSLLAAVTSPVLSRISSASSPNLS 212


>AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subunit
           protein.
          Length = 837

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = +1

Query: 421 SCTRPSGRWCELPSAGLCL 477
           SC RP G  C  P  G C+
Sbjct: 594 SCDRPGGLLCSGPDHGRCV 612


>AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger
           transcription factor pannier protein.
          Length = 537

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 13/49 (26%), Positives = 25/49 (51%)
 Frame = -3

Query: 542 SGLHSEHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPNVRNCGS 396
           +GL+S HI    +  + + +   H+P +G  ++ P G  + P   N G+
Sbjct: 351 AGLNSSHIYTTPSSNSLSTQ-HSHSPVNGYGNNHPTGGSNLPGNNNGGA 398


>AY994096-1|AAX86009.1|   25|Anopheles gambiae 60s ribosomal protein
           L41 protein.
          Length = 25

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/19 (47%), Positives = 15/19 (78%)
 Frame = -2

Query: 261 SQYRKSRHRRIKKQRRYER 205
           +++RK R RR+K++RR  R
Sbjct: 3   AKWRKKRMRRLKRKRRKMR 21


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +3

Query: 534 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSM 641
           + R   GSK     S  + S+ E  RR+P    RSM
Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSM 141


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 738,660
Number of Sequences: 2352
Number of extensions: 14314
Number of successful extensions: 18
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70668195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).