SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          26   0.96 
U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles ...    23   6.8  
AJ697721-1|CAG26914.1|  135|Anopheles gambiae putative odorant-b...    23   9.0  

>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 26.2 bits (55), Expect = 0.96
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = -3

Query: 314  PLVRASSELTVERRSYRIVPSRTKRNRHDLTARK 213
            P    ++  T  RRS  + P R +RN H LT  +
Sbjct: 1028 PTAGENAYSTTHRRSQTLSPVRNERNYHTLTTTR 1061


>U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles
          gambiae putativetubulin alpha chain mRNA, complete cds.
          ).
          Length = 91

 Score = 23.4 bits (48), Expect = 6.8
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = +1

Query: 1  ALRTGACRVWTGSGCGRCRVWSM 69
          ++  G   V  G+ C  C VWSM
Sbjct: 6  SVHVGQAGVQIGNPCWDCTVWSM 28


>AJ697721-1|CAG26914.1|  135|Anopheles gambiae putative
           odorant-binding protein OBPjj11 protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +2

Query: 302 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 391
           +GQ ++D L+ + ++ DGP  C R+    QC
Sbjct: 95  YGQEKADELVARCRNNDGPDACERSFRLLQC 125


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 718,604
Number of Sequences: 2352
Number of extensions: 14639
Number of successful extensions: 29
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68995575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).