SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            24   3.4  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    24   3.4  
AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.    23   4.5  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   4.5  
AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7...    23   6.0  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           23   6.0  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   7.9  
DQ219483-1|ABB29887.1|  961|Anopheles gambiae cryptochrome 2 pro...    23   7.9  
AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled ...    23   7.9  

>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.8 bits (49), Expect = 3.4
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +2

Query: 74   PNASSSN**RA*MD*RDSHCPYLLSSETTAKGTGLGESAGKADPVELDSS 223
            P AS S   R  +   +SH P ++        T LG SAG     E+D++
Sbjct: 2416 PVASLSEGFRKALQIYNSHVPDIVGVLNNHFMTALGRSAGDVQSYEIDAN 2465


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase
            protein.
          Length = 1344

 Score = 23.8 bits (49), Expect = 3.4
 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%)
 Frame = -2

Query: 466  PPGSVLEP-DHAGVLNGD 416
            PPGS+L+P D A V+ G+
Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109


>AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.
          Length = 56

 Score = 23.4 bits (48), Expect = 4.5
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%)
 Frame = +3

Query: 441 SGSRTLP----GGEFDWGGTSVKE 500
           +G+RT+P    GG F  GGT +K+
Sbjct: 21  TGARTVPRVFIGGNFVGGGTDIKK 44


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 4.5
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 487 VPPQSNSPPGSVLEPD 440
           +PP SNS P S   PD
Sbjct: 868 MPPSSNSSPSSYPSPD 883


>AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7
           protein.
          Length = 696

 Score = 23.0 bits (47), Expect = 6.0
 Identities = 8/27 (29%), Positives = 15/27 (55%)
 Frame = -3

Query: 267 ISHLSTPLMSPYNARLESSSTGSAFPA 187
           + +L TP+  PY  ++  S+    +PA
Sbjct: 273 LDNLRTPIPEPYYPKILRSANNRTYPA 299


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.0 bits (47), Expect = 6.0
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -3

Query: 87  DEAFGYLKRVIVTPAVYPRLLEFLHVD 7
           D +F  L RV  TPA  P  +EFL ++
Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLN 659


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 7/24 (29%), Positives = 15/24 (62%)
 Frame = +3

Query: 93  ISDAHEWINEIPTVPIYYLAKPQP 164
           +SD  E ++ +P++P+    +P P
Sbjct: 354 VSDRSESVSPVPSLPVRSSPEPSP 377


>DQ219483-1|ABB29887.1|  961|Anopheles gambiae cryptochrome 2
           protein.
          Length = 961

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +1

Query: 280 SSLENHYFHCFITYSVGRK 336
           SS    +FHC+     GRK
Sbjct: 403 SSFFQQFFHCYCPVKFGRK 421


>AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled
           receptor 3 protein.
          Length = 605

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 11/22 (50%), Positives = 13/22 (59%)
 Frame = -1

Query: 446 TGSRGSFKRRRAFPPRHHSARL 381
           TGS GS  +  AFP  H SA +
Sbjct: 124 TGSAGSSTQIAAFPLDHSSAAI 145


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 550,275
Number of Sequences: 2352
Number of extensions: 12658
Number of successful extensions: 32
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46091631
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).