SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    24   3.6  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    24   4.7  
AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.    23   6.3  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   6.3  
AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2 pro...    23   6.3  
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    23   6.3  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   8.3  

>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +3

Query: 534 TRGARKVTTGITGLWQPSVHSDVAF 608
           TR A +V   I G WQ   H DV+F
Sbjct: 891 TRWAHRVLPNI-GSWQSRKHGDVSF 914


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase
            protein.
          Length = 1344

 Score = 23.8 bits (49), Expect = 4.7
 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%)
 Frame = -2

Query: 355  PPGSVLEP-DHAGVLNGD 305
            PPGS+L+P D A V+ G+
Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109


>AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.
          Length = 56

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%)
 Frame = +3

Query: 330 SGSRTLP----GGEFDWGGTSVKE 389
           +G+RT+P    GG F  GGT +K+
Sbjct: 21  TGARTVPRVFIGGNFVGGGTDIKK 44


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 376 VPPQSNSPPGSVLEPD 329
           +PP SNS P S   PD
Sbjct: 868 MPPSSNSSPSSYPSPD 883


>AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2
           protein.
          Length = 755

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = +3

Query: 501 RPMIL*YKEFLTRGARKVTTGITGLWQPSVHSDVAF 608
           RP    + E+L RG R   +     WQP   S   F
Sbjct: 91  RPTYAAFNEYLPRGYRTELSRFNLKWQPMPFSSKPF 126


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1
           protein.
          Length = 2051

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = +3

Query: 501 RPMIL*YKEFLTRGARKVTTGITGLWQPSVHSDVAF 608
           RP    + E+L RG R   +     WQP   S   F
Sbjct: 91  RPTYAAFNEYLPRGYRTELSRFNLKWQPMPFSSKPF 126


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +2

Query: 155 DRFARSSLKNHYFHCFITYSVGRKRC 232
           DRFA ++    + H F+ +  G + C
Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 693,070
Number of Sequences: 2352
Number of extensions: 15344
Number of successful extensions: 28
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63559560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).