SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450 CY...    27   0.36 
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    25   1.9  
DQ219483-1|ABB29887.1|  961|Anopheles gambiae cryptochrome 2 pro...    25   1.9  
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    23   5.9  
AY187042-1|AAO39756.1|  248|Anopheles gambiae putative antennal ...    23   7.8  
AJ441131-5|CAD29634.1|  574|Anopheles gambiae putative Na+ chann...    23   7.8  

>AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450
           CYP4C28 protein.
          Length = 150

 Score = 27.5 bits (58), Expect = 0.36
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -1

Query: 230 LWCKVERNLRVFPFLEVAQSTVNTGVNSDLVH 135
           L C ++ +LR+FP + +   T+ TGV+ +  H
Sbjct: 61  LECCIKESLRLFPSIPILSRTLTTGVDIEGHH 92


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 9/25 (36%), Positives = 17/25 (68%)
 Frame = -3

Query: 525 VYYAIWSSCFLCLLNKPDIRSVAAH 451
           V+ A+W SC+L  ++K   RS+ ++
Sbjct: 521 VFPALWKSCWLFPVHKKGCRSIVSN 545


>DQ219483-1|ABB29887.1|  961|Anopheles gambiae cryptochrome 2
           protein.
          Length = 961

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 416 NGSFGMKTMRARCAATERMSGLFSKHKKQLLQI 514
           + S G K  R+RC ATE  S L     K+  QI
Sbjct: 838 HASRGAKPHRSRCEATEARSHLADSQVKKEQQI 870


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling
            promoter protein.
          Length = 1197

 Score = 23.4 bits (48), Expect = 5.9
 Identities = 10/15 (66%), Positives = 10/15 (66%)
 Frame = -2

Query: 463  CSSTSGSHCLHSKAS 419
            CSSTS SH  HS  S
Sbjct: 1090 CSSTSSSHSNHSSHS 1104


>AY187042-1|AAO39756.1|  248|Anopheles gambiae putative antennal
           carrier protein TOL-2 protein.
          Length = 248

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -1

Query: 416 LNSKFPVGSFFPICKLKSKV*VLP 345
           +N + PV S     K+K KV +LP
Sbjct: 111 MNLRLPVASLVGSYKIKGKVLILP 134


>AJ441131-5|CAD29634.1|  574|Anopheles gambiae putative Na+ channel
           protein.
          Length = 574

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = +1

Query: 334 PTEAGKTQTLDFSLHIGKKLPTGNFEFKWK 423
           PT+A +    D+ LH G+      F  K K
Sbjct: 503 PTDADRYDAHDYHLHTGRNAMVKEFATKLK 532


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,427
Number of Sequences: 2352
Number of extensions: 13891
Number of successful extensions: 44
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 44
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 60214320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).