SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant r...    24   5.4  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           24   5.4  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    23   7.2  
CR954257-13|CAJ14164.1|  420|Anopheles gambiae predicted protein...    23   7.2  
AY428512-1|AAR89530.1|  420|Anopheles gambiae EKN1 protein.            23   7.2  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    23   7.2  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   9.5  

>AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant
           receptor Or5 protein.
          Length = 391

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +2

Query: 653 ISAGARCFVPSVQSGDVAET 712
           ISAG  CFV   Q G++A+T
Sbjct: 360 ISAGKFCFVDIEQFGNMAKT 379


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -1

Query: 387 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 277
           D +F  L RV  TPA  P  +EFL + D      + HC
Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
            polyprotein protein.
          Length = 1726

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +2

Query: 425  SHCPYLLSSETTAKG-TGLGESAGKEDPVS-LTLVWH 529
            S+CP++L SET       + E   +E  VS L LVW+
Sbjct: 904  SNCPHILPSETEIDNIQRVIELKSREGAVSTLGLVWN 940


>CR954257-13|CAJ14164.1|  420|Anopheles gambiae predicted protein
           protein.
          Length = 420

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 681 GTKHRAPADIIDRAPFPPNR 622
           GT  ++   I+ R PFP NR
Sbjct: 19  GTSSQSVVSIVLRVPFPANR 38


>AY428512-1|AAR89530.1|  420|Anopheles gambiae EKN1 protein.
          Length = 420

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 681 GTKHRAPADIIDRAPFPPNR 622
           GT  ++   I+ R PFP NR
Sbjct: 19  GTSSQSVVSIVLRVPFPANR 38


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = -1

Query: 195 PLNGGRTESCRSRTKRNR 142
           P +GGR  SCRS   R R
Sbjct: 262 PRSGGRWPSCRSPPARRR 279


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 565 DRFARSSLKNHYFHCFITYSVGRKRC 642
           DRFA ++    + H F+ +  G + C
Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 777,404
Number of Sequences: 2352
Number of extensions: 16725
Number of successful extensions: 38
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).