SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146760-1|AAO12075.1|  313|Anopheles gambiae odorant-binding pr...    24   4.2  
AF393487-1|AAL60412.1|  304|Anopheles gambiae odorant binding pr...    24   4.2  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    24   5.5  
AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.    23   7.3  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   7.3  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            23   9.6  

>AY146760-1|AAO12075.1|  313|Anopheles gambiae odorant-binding
           protein AgamOBP31 protein.
          Length = 313

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +1

Query: 433 LSKNNAGVLRPAQRGQKPRVEQKGKTGLIQMFSTHRDC 546
           L  N+   L    +  + RV   G     ++++THRDC
Sbjct: 217 LEVNDLRYLSKETKACRDRVRMSGCDVCSEVYNTHRDC 254


>AF393487-1|AAL60412.1|  304|Anopheles gambiae odorant binding
           protein 1 protein.
          Length = 304

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +1

Query: 433 LSKNNAGVLRPAQRGQKPRVEQKGKTGLIQMFSTHRDC 546
           L  N+   L    +  + RV   G     ++++THRDC
Sbjct: 217 LEVNDLRYLSKETKACRDRVRMSGCDVCSEVYNTHRDC 254


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase
            protein.
          Length = 1344

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%)
 Frame = -1

Query: 409  PPGSVLEP-DHAGVLNGD 359
            PPGS+L+P D A V+ G+
Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109


>AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.
          Length = 56

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%)
 Frame = +3

Query: 384 SGSRTLP----GGEFDWGGTSVKE 443
           +G+RT+P    GG F  GGT +K+
Sbjct: 21  TGARTVPRVFIGGNFVGGGTDIKK 44


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 430 VPPQSNSPPGSVLEPD 383
           +PP SNS P S   PD
Sbjct: 868 MPPSSNSSPSSYPSPD 883


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.0 bits (47), Expect = 9.6
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = +2

Query: 17   PNASSSN**RA*MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 166
            P AS S   R  +   +SH P ++        T LG SAG     E+D++
Sbjct: 2416 PVASLSEGFRKALQIYNSHVPDIVGVLNNHFMTALGRSAGDVQSYEIDAN 2465


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 785,799
Number of Sequences: 2352
Number of extensions: 17279
Number of successful extensions: 35
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).