SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY330180-1|AAQ16286.1|  176|Anopheles gambiae odorant-binding pr...    24   4.3  
AJ618924-1|CAF02003.1|  144|Anopheles gambiae odorant-binding pr...    24   4.3  
AF393486-1|AAL60411.1|  162|Anopheles gambiae twelve cysteine pr...    24   4.3  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           24   5.6  
AY735443-1|AAU08018.1|  163|Anopheles gambiae bursicon protein.        23   7.4  
AY735442-1|AAU08017.1|  163|Anopheles gambiae bursicon protein.        23   7.4  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    23   7.4  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   9.8  
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    23   9.8  

>AY330180-1|AAQ16286.1|  176|Anopheles gambiae odorant-binding
           protein AgamOBP54 protein.
          Length = 176

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = -1

Query: 301 RNH-IASTPARAIAMLCLIRQSDSPCP 224
           R+H +  +P  A  M+CL++ + + CP
Sbjct: 130 RDHDMKCSPVGAFFMMCLMKHTQAKCP 156


>AJ618924-1|CAF02003.1|  144|Anopheles gambiae odorant-binding
           protein OBP5470 protein.
          Length = 144

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = -1

Query: 301 RNH-IASTPARAIAMLCLIRQSDSPCP 224
           R+H +  +P  A  M+CL++ + + CP
Sbjct: 93  RDHDMKCSPVGAFFMMCLMKHTQAKCP 119


>AF393486-1|AAL60411.1|  162|Anopheles gambiae twelve cysteine
           protein 1 protein.
          Length = 162

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = -1

Query: 301 RNH-IASTPARAIAMLCLIRQSDSPCP 224
           R+H +  +P  A  M+CL++ + + CP
Sbjct: 130 RDHDMKCSPVGAFFMMCLMKHTQAKCP 156


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -3

Query: 398 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 288
           D +F  L RV  TPA  P  +EFL + D      + HC
Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670


>AY735443-1|AAU08018.1|  163|Anopheles gambiae bursicon protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -3

Query: 614 KVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVP 477
           +V+  Q+ S +  SH  Y+S     CQ    ++ + +P   PKP+P
Sbjct: 19  RVLYAQKDSEDGGSH--YSSD---DCQVTPVIHVLQYPGCVPKPIP 59


>AY735442-1|AAU08017.1|  163|Anopheles gambiae bursicon protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -3

Query: 614 KVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVP 477
           +V+  Q+ S +  SH  Y+S     CQ    ++ + +P   PKP+P
Sbjct: 19  RVLYAQKDSEDGGSH--YSSD---DCQVTPVIHVLQYPGCVPKPIP 59


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = -3

Query: 206 PLNGGRTESCRSRTKRNR 153
           P +GGR  SCRS   R R
Sbjct: 262 PRSGGRWPSCRSPPARRR 279


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +3

Query: 576 DRFARSSLKNHYFHCFITYSVGRKRC 653
           DRFA ++    + H F+ +  G + C
Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 298 NHIASTPARAIAMLCLIRQSDSPCPCQF 215
           +H+A     ++  +CLI   DS C C F
Sbjct: 801 SHVAVCVIASMVPICLILAEDSEC-CSF 827


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 771,300
Number of Sequences: 2352
Number of extensions: 16442
Number of successful extensions: 36
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 75676146
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).