SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled ...    25   2.0  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    24   4.6  

>AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled
           receptor 3 protein.
          Length = 605

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 243 LLQIHGQVPATHLSNVCLINF 305
           LLQ+ GQ+PAT  +NV +  F
Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 4/93 (4%)
 Frame = -1

Query: 605 FNRNNFSIRYWSWNYRGCWHQTCPPIVPR*NI*---VYSFRLRGLVRVPY-RYFSSLPPV 438
           F R +  +    W++   +  + PP V R +      Y    + L R    RY   L  +
Sbjct: 212 FFREDIGVNLHHWHWHLVYPASGPPDVVRKDRRGELFYYMHQQLLARYQIDRYAQGLGRI 271

Query: 437 PGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 339
             + NLR       +   LR    NRT  PRYP
Sbjct: 272 EPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 647,075
Number of Sequences: 2352
Number of extensions: 14595
Number of successful extensions: 67
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 67
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61468785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).