SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          24   4.6  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          23   6.1  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          23   6.1  
AY735443-1|AAU08018.1|  163|Anopheles gambiae bursicon protein.        23   6.1  
AY735442-1|AAU08017.1|  163|Anopheles gambiae bursicon protein.        23   6.1  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   8.1  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           23   8.1  

>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARSENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 105 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 149


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 107 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 151


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGDERFRHVTT----XHAWNETPCARR 413
           PV    W   EP+HA   NG +            + WN+  C ++
Sbjct: 92  PVLYSQWAAGEPNHARGENGQQPAERCVALAMDKYEWNDFQCTQQ 136


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 92  PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 136


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 102 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 146


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 102 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 146


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 108 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 152


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 109 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 153


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 108 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 152


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 96  PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 140


>EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGDERFRHVTT----XHAWNETPCARR 413
           PV    W   EP+HA   NG +            + WN+  C ++
Sbjct: 96  PVLYSQWAAGEPNHARGENGQQPAERCVALAMDKYEWNDFQCTQQ 140


>EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 96  PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 140


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 99  PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 143


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 110 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 154


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 107 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 151


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 119 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 163


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 119 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 163


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 119 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 163


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 109 PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 153


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%)
 Frame = -1

Query: 535 PVKLPAWQCLEPDHAGVLNGD---ERFRHVT-TXHAWNETPCARR 413
           PV    W   EP+HA   NG    ER   V    + WN+  C ++
Sbjct: 92  PVLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQ 136


>AY735443-1|AAU08018.1|  163|Anopheles gambiae bursicon protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -2

Query: 360 KVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVP 223
           +V+  Q+ S +  SH  Y+S     CQ    ++ + +P   PKP+P
Sbjct: 19  RVLYAQKDSEDGGSH--YSSD---DCQVTPVIHVLQYPGCVPKPIP 59


>AY735442-1|AAU08017.1|  163|Anopheles gambiae bursicon protein.
          Length = 163

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -2

Query: 360 KVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVP 223
           +V+  Q+ S +  SH  Y+S     CQ    ++ + +P   PKP+P
Sbjct: 19  RVLYAQKDSEDGGSH--YSSD---DCQVTPVIHVLQYPGCVPKPIP 59


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 322 DRFARSSLKNHYFHCFITYSVGRKRC 399
           DRFA ++    + H F+ +  G + C
Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 144 DEAFGYLKRVIVTPAVYPRLLEFLHVD 64
           D +F  L RV  TPA  P  +EFL ++
Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLN 659


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 657,381
Number of Sequences: 2352
Number of extensions: 12913
Number of successful extensions: 56
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61886940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).