SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    24   3.5  
AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript...    23   8.1  

>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 24.2 bits (50), Expect = 3.5
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = -3

Query: 494 FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEVRGNPD 372
           + T E    +SV  G     +LGP  W TM  G +++   PD
Sbjct: 611 YETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDIALPPD 652


>AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1022

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +2

Query: 494 ITNVADNFILPERTSSVRLHF 556
           + N  D F+ PER S++ L F
Sbjct: 159 MNNGQDTFVTPERKSAIDLTF 179


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 669,411
Number of Sequences: 2352
Number of extensions: 14066
Number of successful extensions: 82
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 82
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62305095
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).