SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    29   0.15 
AY578808-1|AAT07313.1|  458|Anopheles gambiae saxophone protein.       27   0.36 
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          27   0.62 
DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.        26   1.1  
DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.        26   1.1  
AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.      26   1.1  
AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled ...    25   2.5  
AJ697726-1|CAG26919.1|  198|Anopheles gambiae putative odorant-b...    24   3.3  

>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 28.7 bits (61), Expect = 0.15
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 7/58 (12%)
 Frame = +1

Query: 322 LPWLSRVTGNQG-----SIPEREPEKRLP--HPRKAAGAQITHSRHGSFSGLPGPLGQ 474
           LP LS + GN G      IP  + EK  P  HP      Q     +    GLPGP G+
Sbjct: 188 LPGLSGLPGNPGPRGYAGIPGTKGEKGEPARHPENYNKGQKGEPGNDGLEGLPGPQGE 245


>AY578808-1|AAT07313.1|  458|Anopheles gambiae saxophone protein.
          Length = 458

 Score = 27.5 bits (58), Expect = 0.36
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +1

Query: 349 NQGSIPEREPEKRLPHPRKAAGAQITHS-RHGSFSGLP 459
           N GS PE  P +   + +K +   + HS   GS SGLP
Sbjct: 103 NNGSFPELPPMRGKTYSKKLSFEYLQHSVTSGSGSGLP 140


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 26.6 bits (56), Expect = 0.62
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +1

Query: 478  EHADSFSVARGGPGHLRASQTCYCSISCGSKTPVPLR 588
            EH++SFS   G P    A +  Y +    S+T  P+R
Sbjct: 1013 EHSNSFSYNYGSPAFPTAGENAYSTTHRRSQTLSPVR 1049


>DQ986315-1|ABK59975.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980210-1|ABL09378.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980209-1|ABL09377.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980208-1|ABL09376.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980207-1|ABL09375.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980206-1|ABL09374.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980205-1|ABL09373.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980204-1|ABL09372.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980203-1|ABL09371.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980202-1|ABL09370.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980201-1|ABL09369.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980200-1|ABL09368.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>DQ980199-1|ABL09367.1|  504|Anopheles gambiae catalase protein.
          Length = 504

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 465 HLKDASPFLQERAVK 479


>AY505416-1|AAR90327.1|  485|Anopheles gambiae catalase 1 protein.
          Length = 485

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 286 HLKDASPVLDQRSAK 242
           HLKDASP L +R+ K
Sbjct: 449 HLKDASPFLQERAVK 463


>AY500851-1|AAS77205.1|  605|Anopheles gambiae G-protein coupled
           receptor 3 protein.
          Length = 605

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +1

Query: 241 LLQIAGQVPATHLSNVCLINF 303
           LLQ+ GQ+PAT  +NV +  F
Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494


>AJ697726-1|CAG26919.1|  198|Anopheles gambiae putative
           odorant-binding protein OBPjj16 protein.
          Length = 198

 Score = 24.2 bits (50), Expect = 3.3
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 456 QPAETPVPGVGNLRACCL 403
           +P + P PGV     CC+
Sbjct: 58  KPGQMPAPGVPRTEGCCI 75


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 642,486
Number of Sequences: 2352
Number of extensions: 14642
Number of successful extensions: 75
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 74
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58870980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).