SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043433-1|AAC05656.1|  231|Anopheles gambiae putative pupal-spe...    25   1.7  
AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript...    24   4.0  
AY028782-1|AAK32956.1|  501|Anopheles gambiae cytochrome P450 pr...    24   5.3  
M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles ...    23   7.0  
DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.           23   9.3  
AY341205-1|AAR13769.1|  285|Anopheles gambiae period protein.          23   9.3  
AY341204-1|AAR13768.1|  285|Anopheles gambiae period protein.          23   9.3  
AY341203-1|AAR13767.1|  285|Anopheles gambiae period protein.          23   9.3  
AY341202-1|AAR13766.1|  285|Anopheles gambiae period protein.          23   9.3  
AB090815-1|BAC57905.1|  492|Anopheles gambiae gag-like protein p...    23   9.3  

>AF043433-1|AAC05656.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +2

Query: 83  YHQDLHRRRLQAGSRPDPSALSVAH-VLLVTA**YQIKNLASHVPVTVVYRQNASAPSIS 259
           YH D H     A  RP+PSA+ +A  V  V A    + + A H PV     Q+  A  I+
Sbjct: 128 YHAD-HHTGFNAVVRPEPSAVKIAQPVHKVIAQPVHVSSYA-HAPVAHATVQHHHAAPIA 185


>AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1009

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +2

Query: 32  ETLLHVSPPGPRWSICYYHQDLHRRRLQAGSRPDPSALSVAHVLLVTA 175
           +++ ++S P   WSI Y+ +D+    +QA    + +       +LVTA
Sbjct: 210 QSVRNLSRPITGWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTA 257


>AY028782-1|AAK32956.1|  501|Anopheles gambiae cytochrome P450
           protein.
          Length = 501

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = +3

Query: 225 CIGKTLQRHPFQGWLLRQVSRCTLLSGFRLPWP 323
           CI ++L+++P    L+RQVS+   + G  + +P
Sbjct: 359 CINESLRKYPPGANLIRQVSQDYRVPGTDVTFP 391


>M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 574

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +1

Query: 31  RNPSPRQSSRASLEYLLLPPRSAPTEAPSG 120
           RN   ++  RAS    ++PPRS    A  G
Sbjct: 225 RNQHEQEQPRASTSRAVMPPRSEALTAVRG 254


>DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.
          Length = 407

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 2/27 (7%)
 Frame = +2

Query: 440 PTWHRHQISG--FIVRVSRSSHPFKFE 514
           P++HRHQ+ G  F + +++    F F+
Sbjct: 211 PSYHRHQLVGDDFFLAIAKWELGFSFD 237


>AY341205-1|AAR13769.1|  285|Anopheles gambiae period protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -1

Query: 352 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 263
           G G +    GG GS  P    + L C+ N+
Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282


>AY341204-1|AAR13768.1|  285|Anopheles gambiae period protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -1

Query: 352 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 263
           G G +    GG GS  P    + L C+ N+
Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282


>AY341203-1|AAR13767.1|  285|Anopheles gambiae period protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -1

Query: 352 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 263
           G G +    GG GS  P    + L C+ N+
Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282


>AY341202-1|AAR13766.1|  285|Anopheles gambiae period protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -1

Query: 352 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 263
           G G +    GG GS  P    + L C+ N+
Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282


>AB090815-1|BAC57905.1|  492|Anopheles gambiae gag-like protein
           protein.
          Length = 492

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 14/30 (46%), Positives = 15/30 (50%)
 Frame = +2

Query: 191 KNLASHVPVTVVYRQNASAPSISGLVASAG 280
           +NL S        R    APS S LVASAG
Sbjct: 174 RNLRSTEEADDAKRAKNDAPSGSSLVASAG 203


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 772,689
Number of Sequences: 2352
Number of extensions: 17218
Number of successful extensions: 297
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 296
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 297
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).