SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    26   1.2  
AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein ...    24   3.8  
AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.    24   5.0  
AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           24   5.0  
AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein p...    24   5.0  
AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450 pr...    23   8.8  
AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative transcrip...    23   8.8  

>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = -2

Query: 555 VPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLG 448
           +PP SNS P S   PD      A++ S++S L   G
Sbjct: 868 MPPSSNSSPSSYPSPDVVISGLASNNSSSSNLVAAG 903


>AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein
           protein.
          Length = 680

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = -2

Query: 546 QSNSPPGSVLEPDTREF*TATSVSATSPLCTLGTKHRAPADIID 415
           ++ SPP     P T    TAT  +AT+    L +  + PA+ +D
Sbjct: 558 KATSPPAVATPPSTSRARTATR-TATTTTRALRSAKKEPAESLD 600


>AY745229-1|AAU93509.1|   56|Anopheles gambiae glutaredoxin protein.
          Length = 56

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 4/25 (16%)
 Frame = +2

Query: 506 VSGSRTLP----GGEFDWGGTSVKE 568
           ++G+RT+P    GG F  GGT +K+
Sbjct: 20  LTGARTVPRVFIGGNFVGGGTDIKK 44


>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -2

Query: 156 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 46
           D +F  L RV  TPA  P  +EFL + D      + HC
Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670


>AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein
           protein.
          Length = 541

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = -2

Query: 552 PPQSNSPPGSVLEPDTREF*TATS--VSATSPLCTLGTKHRAPAD 424
           PP  N PPGS   P      T TS  + A+S + T  +   A  D
Sbjct: 5   PPGVNRPPGSHRPPGLSNPPTCTSAKMMASSGMSTRASARSASVD 49


>AY095933-1|AAM34435.1|  505|Anopheles gambiae cytochrome P450
           protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 334 DRFARSSLKNHYFHCFITYSVGRKRC 411
           DRFA ++    + H F+ +  G + C
Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450


>AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative
           transcription factor protein.
          Length = 593

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = -3

Query: 353 DDRAKRSPTYATPLMSPYNARLXSSSTGSSFPAILPSPFPWLWFR 219
           +D  K SP +  PL+S           G SFP   P+ +P  W R
Sbjct: 331 NDYFKGSPAHRKPLLS----------MGISFPIFFPTYWPHYWNR 365


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 749,518
Number of Sequences: 2352
Number of extensions: 16453
Number of successful extensions: 37
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).