SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              28   0.14 
EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.          27   0.32 
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          25   1.3  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          25   1.3  
M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles ...    24   2.3  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            23   3.9  
AJ302656-1|CAC35521.1|  385|Anopheles gambiae gSG1b protein prot...    23   5.2  
EF426194-1|ABO26437.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426193-1|ABO26436.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426192-1|ABO26435.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426191-1|ABO26434.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426190-1|ABO26433.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426189-1|ABO26432.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426188-1|ABO26431.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426187-1|ABO26430.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426185-1|ABO26428.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426184-1|ABO26427.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426183-1|ABO26426.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426182-1|ABO26425.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426181-1|ABO26424.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426180-1|ABO26423.1|  133|Anopheles gambiae unknown protein.         22   6.9  
EF426179-1|ABO26422.1|  133|Anopheles gambiae unknown protein.         22   6.9  
AJ973471-1|CAJ01518.1|  122|Anopheles gambiae hypothetical prote...    22   6.9  
AJ697731-1|CAG26924.1|  122|Anopheles gambiae putative chemosens...    22   6.9  
AJ697730-1|CAG26923.1|  122|Anopheles gambiae putative chemosens...    22   6.9  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          22   9.1  
AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic acetylch...    22   9.1  
AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein p...    22   9.1  

>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 27.9 bits (59), Expect = 0.14
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%)
 Frame = +2

Query: 206 QKAQGAPQS---SGKSHDEPRRHQNQRQSEKSARGRLVESSMAVS*TY 340
           Q+ Q  PQ    +G S  + ++HQ Q+Q  K  +  L+E S   + T+
Sbjct: 351 QQQQRQPQRYVVAGSSQQQQQQHQQQQQKRKRPKPELIEISPGQNETF 398



 Score = 22.2 bits (45), Expect = 6.9
 Identities = 15/53 (28%), Positives = 22/53 (41%)
 Frame = +2

Query: 146 RSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           R     + ELQ      P    AQGA  S  +   +  + Q QRQ ++  + R
Sbjct: 181 RMGARSVIELQQQAAAAPM-MTAQGAHSSRNRRGRQGPQQQEQRQQQQQHQQR 232


>EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 26.6 bits (56), Expect = 0.32
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = -1

Query: 308 RVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +V  +PISR++  FGAV   H +     E+L   E R
Sbjct: 35  KVYFIPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 34  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 66


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 36  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 68


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 21  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 53


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 21  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 53


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 31  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 63


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 31  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 63


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 37  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 69


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 38  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 70


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 37  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 69


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 25  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 57


>EF519450-1|ABP73509.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 25  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 57


>EF519449-1|ABP73507.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 25  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 57


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 28  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 60


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 39  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 71


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 36  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 68


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 48  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 80


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 48  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 80


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 48  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 80


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 38  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 70


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 24.6 bits (51), Expect = 1.3
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELLALFEPR 198
           +PISR++  FGAV   H +     E+L   E R
Sbjct: 21  IPISRTSDWFGAVAYCHSVGMELAEVLNEDEAR 53


>M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 574

 Score = 23.8 bits (49), Expect = 2.3
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 209 KAQGAPQSSGKSHDEPRRHQNQRQSEKSARG 301
           KA G P    +S  +P++ Q QRQ ++ A G
Sbjct: 273 KATGKP----RSQQQPQQQQQQRQLQRQAVG 299


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.0 bits (47), Expect = 3.9
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +2

Query: 74   RSHFGVKRCWTTDGKII 124
            R+HFG ++ WT D  +I
Sbjct: 1345 RNHFGKEKKWTFDKTLI 1361


>AJ302656-1|CAC35521.1|  385|Anopheles gambiae gSG1b protein
           protein.
          Length = 385

 Score = 22.6 bits (46), Expect = 5.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -2

Query: 121 YFPICCPAALNAEMRAGLQKDIMT*FGQ 38
           YF +C P        AGL  ++   FG+
Sbjct: 335 YFEVCLPEIRKDPATAGLVTEVQNIFGR 362


>EF426194-1|ABO26437.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426193-1|ABO26436.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426192-1|ABO26435.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426191-1|ABO26434.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426190-1|ABO26433.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426189-1|ABO26432.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426188-1|ABO26431.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426187-1|ABO26430.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426185-1|ABO26428.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426184-1|ABO26427.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426183-1|ABO26426.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426182-1|ABO26425.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426181-1|ABO26424.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426180-1|ABO26423.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>EF426179-1|ABO26422.1|  133|Anopheles gambiae unknown protein.
          Length = 133

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 324 RYLELIHRCNT 356
           RYL L H CNT
Sbjct: 58  RYLTLTHTCNT 68


>AJ973471-1|CAJ01518.1|  122|Anopheles gambiae hypothetical protein
           protein.
          Length = 122

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           T +G+ +  LPD  ++  E+  E Q   ++   A   +  PQ   K  D+
Sbjct: 55  TQEGRELKTLPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDK 104


>AJ697731-1|CAG26924.1|  122|Anopheles gambiae putative chemosensory
           protein CSP2 protein.
          Length = 122

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           T +G+ +  LPD  ++  E+  E Q   ++   A   +  PQ   K  D+
Sbjct: 55  TQEGRELKTLPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDK 104


>AJ697730-1|CAG26923.1|  122|Anopheles gambiae putative chemosensory
           protein CSP1 protein.
          Length = 122

 Score = 22.2 bits (45), Expect = 6.9
 Identities = 13/50 (26%), Positives = 23/50 (46%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDE 253
           T +G+ +  LPD  ++  E+  E Q   ++   A   +  PQ   K  D+
Sbjct: 55  TQEGRELKTLPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDK 104


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = -1

Query: 296 LPISRSAADFGAVLVRHEISQMTEELL 216
           +PISR++   GAV   H +     E+L
Sbjct: 39  IPISRTSDWLGAVAYCHSVGMELAEVL 65


>AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 1 protein.
          Length = 557

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 7/24 (29%), Positives = 15/24 (62%)
 Frame = +3

Query: 270 ISGRARNRQEDDSSKVVWRYLELI 341
           ++   RN+ + +S K  W+Y+ L+
Sbjct: 478 VAQHVRNKDKFESVKEDWKYVALV 501


>AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein
           protein.
          Length = 357

 Score = 21.8 bits (44), Expect = 9.1
 Identities = 11/29 (37%), Positives = 13/29 (44%)
 Frame = +2

Query: 236 GKSHDEPRRHQNQRQSEKSARGRLVESSM 322
           G S DEPR    +R +E         SSM
Sbjct: 305 GPSTDEPRTVTRKRTTESDVESDASSSSM 333


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,874
Number of Sequences: 2352
Number of extensions: 6554
Number of successful extensions: 72
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 71
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 30356973
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).