SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450 pr...    24   4.1  
AF042732-2|AAC18057.1|  179|Anopheles gambiae TU37B2 protein.          24   4.1  
AY193730-1|AAO62003.1|  441|Anopheles gambiae cytochrome P450 CY...    23   9.5  

>AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450
           protein.
          Length = 509

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = -1

Query: 288 VSITADAVHRQPAHKCNYELFNRNNFS 208
           V I   A+H  PAH    E F+ + FS
Sbjct: 406 VQIPVYAIHHDPAHYPEPECFDPDRFS 432


>AF042732-2|AAC18057.1|  179|Anopheles gambiae TU37B2 protein.
          Length = 179

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +3

Query: 567 SWIVARRTSAKAFAKGVFINQERKLEVRK 653
           +W++  RT      KG    Q +KLE RK
Sbjct: 23  TWVMVYRTEKYQKLKGEVEKQSKKLEKRK 51


>AY193730-1|AAO62003.1|  441|Anopheles gambiae cytochrome P450
           CYPm3r10 protein.
          Length = 441

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 10/39 (25%), Positives = 18/39 (46%)
 Frame = -1

Query: 288 VSITADAVHRQPAHKCNYELFNRNNFSIRYWSWNYRGCW 172
           V +   A+HR P H  + E F+ + F+    +  +   W
Sbjct: 336 VMVPVHAIHRDPEHFPDPERFDPDRFTAEQEAKRHPYAW 374


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 735,779
Number of Sequences: 2352
Number of extensions: 14856
Number of successful extensions: 30
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).