SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF295693-1|AAL55241.1|  786|Anopheles gambiae polyprotein protein.     48   3e-07
AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein pr...    48   4e-07
EF592176-1|ABQ95972.2|  661|Anopheles gambiae laccase-3 protein.       25   3.7  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          25   3.7  
AJ439398-4|CAD28127.1|  572|Anopheles gambiae putative sodium ch...    24   4.9  
AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.            24   4.9  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            24   6.5  

>AF295693-1|AAL55241.1|  786|Anopheles gambiae polyprotein protein.
          Length = 786

 Score = 48.4 bits (110), Expect = 3e-07
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 3/99 (3%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE- 641
           P+II +DQG  +S++ +++     GIK  F + Y PQ  G  ER + +L E  R  + + 
Sbjct: 402 PRIIRSDQGGEYSNKALRKFCADEGIKMEFTAAYSPQQNGVAERKNRSLTEMGRCMLRDA 461

Query: 640 --NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
             ++  W   + TA    N    +    +P E+ FG KP
Sbjct: 462 GMHKRFWAEAVNTACYLQNRLPSAAVERTPFEIWFGRKP 500


>AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein
           protein.
          Length = 942

 Score = 48.0 bits (109), Expect = 4e-07
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 3/99 (3%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           P +I +DQG  + S+ + Q  R  GI   F + Y PQ  G  ER + TL E  R  +++ 
Sbjct: 137 PIVIRSDQGGEYKSKRLGQFYRAKGIVPQFTAGYSPQQNGVAERKNRTLVEMARCMLIDA 196

Query: 637 QHTWDLYLRTAMLA-YNSNIHSTTGF--SPLELLFGFKP 530
           +  +  +      A Y  NI S+     +P EL +G +P
Sbjct: 197 KLGYRFWAEAINAAVYLQNISSSRSIEKTPFELWYGKQP 235


>EF592176-1|ABQ95972.2|  661|Anopheles gambiae laccase-3 protein.
          Length = 661

 Score = 24.6 bits (51), Expect = 3.7
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = -1

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL-DLNTYSDYI 476
           Y  T   AY+++     G    +L FGF  Y P S +S+ + N Y  Y+
Sbjct: 411 YCITDFQAYDTDEDVINGVPDHQLTFGFYNY-PVSFESMFESNRYEHYM 458


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 24.6 bits (51), Expect = 3.7
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +3

Query: 111 ESQTRAGDEIASFLRYCRMCG 173
           E + R G  IA++L+Y ++CG
Sbjct: 150 EDKHRLGTAIAAYLQYQKICG 170


>AJ439398-4|CAD28127.1|  572|Anopheles gambiae putative sodium
           channel protein.
          Length = 572

 Score = 24.2 bits (50), Expect = 4.9
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 547 LFGFKPYIPKSIDSLDLNTYSDYIRALNHRLYYSR 443
           LFG KP    +I  L   TY+D   A ++ L+  R
Sbjct: 486 LFGSKPSTTTAIQFLGRPTYADRYDANDYHLHAGR 520


>AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.
          Length = 1152

 Score = 24.2 bits (50), Expect = 4.9
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +2

Query: 677 RMTSF*GATSLRVIWRSKNVFYSE*TL*LLHYF 775
           ++ SF G T ++V+W   N  + +    + H+F
Sbjct: 123 QLVSFLGTTQVKVLWLKNNANHEQSASLVRHHF 155


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +2

Query: 77  FKILQTRFCNSRKPNEGRRRNRFVPSLLSDVWNVW 181
           F+I      N   PN GRRR    P+    ++ VW
Sbjct: 9   FEITDYDLANEFNPNRGRRR----PTKNQQIYGVW 39


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 765,440
Number of Sequences: 2352
Number of extensions: 15255
Number of successful extensions: 76
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 75
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 76
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 87734433
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).