SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    25   2.5  
DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domai...    25   3.2  
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    25   3.2  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          24   5.7  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           24   5.7  
AY578812-1|AAT07317.1|  932|Anopheles gambiae wishful thinking p...    23   7.5  

>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = +1

Query: 220 VCSHTSRTRSARGPCTWAERPRLPPPVPDRHILQLHK 330
           VCS +S    A   C   +RP+  PP  DR + +L +
Sbjct: 380 VCSFSSFMLQAFVVCVPVQRPKPNPPWADRTLKRLKR 416



 Score = 23.8 bits (49), Expect = 5.7
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +2

Query: 662 YVCMSLVCISACMYVSRMYI 721
           Y+C+ + C +A +YV  +YI
Sbjct: 171 YICVRVACNNAHLYVMVVYI 190


>DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 103

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 1/25 (4%)
 Frame = +1

Query: 214 GCVCSHTSRTRSARGPCTWAER-PR 285
           GC C      R+  G C WA++ PR
Sbjct: 71  GCFCKKNYVRRAIGGSCIWAKKCPR 95


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 24.6 bits (51), Expect = 3.2
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = +1

Query: 34  CFTAEIVIMILYMSDFADTSRGGRLA 111
           CF  E+ I  L   DF++TS   +LA
Sbjct: 222 CFNEELFIEALRFGDFSNTSSALKLA 247


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = -2

Query: 142  PVPGDQQSGPQPTALLDSYLQNPT 71
            P PG Q +GP    L+  +L  PT
Sbjct: 1262 PPPGVQYTGPNSEELVRHFLVEPT 1285


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 16/70 (22%), Positives = 21/70 (30%)
 Frame = -2

Query: 280 DARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTA 101
           D+    T HAPT     +    P      T    P  T   H+            P PT 
Sbjct: 191 DSTATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPTTTTTWSDLPPPPPTT 250

Query: 100 LLDSYLQNPT 71
              +   +PT
Sbjct: 251 TTTTVWTDPT 260



 Score = 23.4 bits (48), Expect = 7.5
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +1

Query: 196 PPCSGRGCVCSHTSRTRSARGPCTWAERPRLPPPVP 303
           PP +    V + ++ T +   P T      LPPP P
Sbjct: 180 PPTTTTTTVWTDSTATTTTHAPTTTTTWSDLPPPPP 215


>AY578812-1|AAT07317.1|  932|Anopheles gambiae wishful thinking
           protein.
          Length = 932

 Score = 23.4 bits (48), Expect = 7.5
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = +3

Query: 222 LLAHQPHAVGAWTVYMGRAS 281
           LL H+PH+VG  T   G  S
Sbjct: 761 LLLHEPHSVGNVTATEGAVS 780


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 762,818
Number of Sequences: 2352
Number of extensions: 14820
Number of successful extensions: 40
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76091949
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).