SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    47   7e-07
AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    40   1e-04
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    38   3e-04
AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript...    27   0.62 
AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript...    26   1.4  
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    24   4.4  
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    24   5.8  

>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
            gambiae T1 retroposon. ).
          Length = 975

 Score = 46.8 bits (106), Expect = 7e-07
 Identities = 61/258 (23%), Positives = 104/258 (40%), Gaps = 15/258 (5%)
 Frame = -3

Query: 746  NYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAP 567
            N++  D   L   ++  DWS   +  ++++ V SFN  + S      P+   R    P P
Sbjct: 278  NFRLTDYRKLNSILSRADWSFFYQCTSVDEAVQSFNALLTSALLSCTPI--FRSPPNP-P 334

Query: 566  WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR-- 393
            W    ++ L               +  +  ++K   +  +RL   A+   +   L++R  
Sbjct: 335  WSNRTLRNLKKDRMKYLRRYRLNRSAFNFRLFKYAAS-AHRLYNRARFEAYSSRLQSRFR 393

Query: 392  -SPAHTWRFLK-SVGIGKTPVSSVKDT-------DLCAL-NKHFSL---PPVSLSDSSKT 252
              PA  W+F++   G    P   V D+       ++C L + HFS    PPVS  +  + 
Sbjct: 394  SDPASFWQFVRIRRGCNTLPNEMVLDSRTASTPVEICELFSAHFSQMFEPPVSDPNLIEG 453

Query: 251  ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPIL 72
              L    +L    I + ++S  S   V+  F    S   G D + + ++      +AP L
Sbjct: 454  GLLYTPENL----INLSDISVSSETVVQVLFGLKRSFTPGPDGIPASVLINCKDVLAPHL 509

Query: 71   TDIFNFSFTSSNFPDSWK 18
              IFN S +   FP  WK
Sbjct: 510  AKIFNLSLSLGVFPALWK 527


>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 39.5 bits (88), Expect = 1e-04
 Identities = 38/188 (20%), Positives = 72/188 (38%), Gaps = 1/188 (0%)
 Frame = -3

Query: 578 KPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSL-AIYKALRNRCNRLCRDAKRLYFHKSL 402
           +PA W TP I+ L              PT+  + A+ +  R+      R +K+ +F + L
Sbjct: 292 RPAYWCTPAIEELENECRIAEQRQLASPTDPDISALDRQARHALKTAIRASKKQFFDRML 351

Query: 401 ENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLS 222
           +      T + ++ V     P  + +D D   L    S+     SD S      +     
Sbjct: 352 QALHDDETGQCIRKVLYRLQPSRTAQDRDPVVLK---SVVSTMFSDHSPAEWPTEDKHEI 408

Query: 221 VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
             R+P+ E++ + +  + +        A G+D V +  +A  +         ++      
Sbjct: 409 GNRVPLREVTDLELQIIASGMQP--RKAPGLDGVPNAALASAIKNYPGSFRQVYQECLDR 466

Query: 41  SNFPDSWK 18
           S FP+ WK
Sbjct: 467 SCFPEQWK 474


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
            transcriptase protein.
          Length = 1049

 Score = 37.9 bits (84), Expect = 3e-04
 Identities = 56/227 (24%), Positives = 88/227 (38%), Gaps = 10/227 (4%)
 Frame = -3

Query: 668  NINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTE 489
            ++++ V SF+  ++  F    PV+R   K  P PW    +K L                +
Sbjct: 375  SLDEAVCSFSSFMLQAFVVCVPVQRP--KPNP-PWADRTLKRLKRVKRAAYRHYQTRRCQ 431

Query: 488  HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN--RSPAHTWRFLKS-VGIGKTPVS-SVKD 321
             S +IY    +      R   R Y  K   N  R P   WRF  S      TP S + K 
Sbjct: 432  RSRSIYFDTHSLYCSYNRFRYRRYLSKIQRNLCRWPDSFWRFYNSKTKSTHTPKSITYKG 491

Query: 320  TDLCALNKHFSLPPVSLSDSSKTAT----LLKISSLSVPRIPIFELSPVSVADVRNSFFS 153
                  N+  +L     +D    A      +  + ++ P   I   +P   +++  S  +
Sbjct: 492  ATSANTNEMCNLFADRFADCFSPAMNDTDTIDAALVNTPAGAINMSTPFIDSEIVLSALA 551

Query: 152  I--SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
                S A G D + S ++     TVAPIL  +FN S  +  FP +W+
Sbjct: 552  QLKPSFAPGPDGIPSTVLKRCQTTVAPILAKLFNASLANGYFPKAWR 598


>AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1022

 Score = 27.1 bits (57), Expect = 0.62
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 3/62 (4%)
 Frame = -3

Query: 194 SPVSVAD--VRNSFFSISSTAV-GIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
           +P SV D  +RN   S+ S  V G D + +  +A  +     I   ++     +  FPD+
Sbjct: 397 NPESVTDEEIRNIGRSLKSRKVPGPDGIPNAALATAMIEEPTIFKKVYQRCLDTGVFPDN 456

Query: 23  WK 18
           WK
Sbjct: 457 WK 458


>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1222

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 14/64 (21%), Positives = 27/64 (42%)
 Frame = -3

Query: 209 PIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFP 30
           P+ +++   + D+ +S       A G+D V +  +   +     I   +F     +  FP
Sbjct: 415 PVRDVNEQELLDIASSLNP--RKAPGLDGVPNAALTAAIRKHTDIFKKLFQECLDNERFP 472

Query: 29  DSWK 18
           D WK
Sbjct: 473 DEWK 476


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 10/41 (24%), Positives = 18/41 (43%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           A GID + +  I   +     +  ++   + T+  FP  WK
Sbjct: 471 APGIDGIPNMAIKAAMLAYPDVFKNVLMNTLTTGQFPSMWK 511


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 11/73 (15%), Positives = 30/73 (41%)
 Frame = -3

Query: 236 ISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFN 57
           +S ++     + +++P  + D+ +     +  A G+D + +  +   +     +   ++ 
Sbjct: 414 VSDVTQGEASVDDVTPRELQDIAHQM--ATRKAPGLDGIPNAAVKAAIGMYPDVFCRMYQ 471

Query: 56  FSFTSSNFPDSWK 18
              T   FP  WK
Sbjct: 472 DCLTRGTFPSEWK 484


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 778,920
Number of Sequences: 2352
Number of extensions: 16322
Number of successful extensions: 39
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77755161
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).