SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    26   1.6  
AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical prot...    26   1.6  
AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    25   2.9  
AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein p...    25   3.8  
AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    24   5.0  
CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative calcium/c...    24   6.6  
AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic pr...    23   8.7  
AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenin...    23   8.7  
AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta...    23   8.7  

>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 25.8 bits (54), Expect = 1.6
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -2

Query: 569 RTSCGTRATRTSSKITSRANSNSYSTNR*LSSSA 468
           RTS G+  T T++   S A+S S + +  +SSSA
Sbjct: 500 RTSIGSEITTTNTHPKSSASSTSLNHSNPISSSA 533


>AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical protein
           protein.
          Length = 765

 Score = 25.8 bits (54), Expect = 1.6
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -2

Query: 569 RTSCGTRATRTSSKITSRANSNSYSTNR*LSSSA 468
           RTS G+  T T++   S A+S S + +  +SSSA
Sbjct: 501 RTSIGSEITTTNTHPKSSASSTSLNHSNPISSSA 534


>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 25.0 bits (52), Expect = 2.9
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -1

Query: 624 RDVVSRLVSQGIKNTMSFAYKLWHE 550
           R  +SRL++    +TM +A  +WHE
Sbjct: 848 RTSMSRLLANVADSTMRYAAPVWHE 872


>AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein
           protein.
          Length = 344

 Score = 24.6 bits (51), Expect = 3.8
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +2

Query: 173 NSCWSPTFTGYKDQVCLFSLEPFD 244
           N CW    +G+K Q C  S++  D
Sbjct: 297 NLCWKCGLSGHKKQACTNSVKCLD 320


>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 24.2 bits (50), Expect = 5.0
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = -1

Query: 774 KTQTAFSTKMVFADATSINNHLYNLVTGGDYINAVKTVRS 655
           +T   F+   V  +   INN     +T G+ + A+K  +S
Sbjct: 419 QTDDTFTCTRVIPEDCEINNGCMEEITSGEILYAIKNSQS 458


>CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative
           calcium/calmodulin-dependentprotein kinase, CAKI
           protein.
          Length = 872

 Score = 23.8 bits (49), Expect = 6.6
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 648 DNQGSDVCRDVVSRLVS 598
           D +GSD+C +VV R V+
Sbjct: 72  DMEGSDICFEVVRRAVA 88


>AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic
           protein.
          Length = 379

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 2/27 (7%)
 Frame = -3

Query: 574 VRVQAVARGPQGH--RRRLLPERIPTH 500
           V+V    RGP GH  +RR +   +P H
Sbjct: 189 VQVTGRGRGPPGHSRQRRSIVPAVPVH 215


>AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenine
           transaminase protein.
          Length = 396

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 7/45 (15%)
 Frame = -3

Query: 469 QTLQSSSQTGC*RWRVQRPPD-------LGRRKRLHQPPCQLATH 356
           + ++ S + G     ++ PPD       L R   LHQP C   TH
Sbjct: 107 RAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFLTH 151


>AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing
            phosphoprotein protein.
          Length = 1200

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +3

Query: 51   SRSTRGCRRLSRCSPTQGGPRMSPRSRPASVPAGT--PGSR 167
            S S +G R  SR     GG R   RSR  S  AG+   GSR
Sbjct: 1109 SGSAKGSRSRSRSG--SGGSRSRSRSRSRSQSAGSRKSGSR 1147


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 815,441
Number of Sequences: 2352
Number of extensions: 16006
Number of successful extensions: 65
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 59
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 88891965
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).