SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY505417-1|AAR90328.1|  206|Anopheles gambiae superoxide dismuta...   264   2e-72
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    27   1.0  
AY255856-1|AAP13482.1|  248|Anopheles gambiae glutathione transf...    25   4.1  
AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative 5'-nucleo...    24   7.1  
AJ000034-1|CAA03870.1|   98|Anopheles gambiae 5'-nucleotidase pr...    24   7.1  
AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide recepto...    23   9.4  

>AY505417-1|AAR90328.1|  206|Anopheles gambiae superoxide dismutase
           1 protein.
          Length = 206

 Score =  264 bits (648), Expect = 2e-72
 Identities = 117/174 (67%), Positives = 135/174 (77%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           R KHTLP+LPY++ ALEPVI REIM LHH KHH  Y+ NLN AEE+L  A AK D+  II
Sbjct: 31  RSKHTLPDLPYDFGALEPVICREIMELHHQKHHNAYVTNLNAAEEQLQDAVAKQDVSKII 90

Query: 321 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            L  A+KFNGGGHINHSIFW NLSP+   PS  L KA+ +DF + +N K ++  A+VAVQ
Sbjct: 91  QLGNAIKFNGGGHINHSIFWKNLSPDRSDPSAELQKALNRDFQNMENFKKEMKAAAVAVQ 150

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVR 662
           GSGW WLGYNK+ K LQIA C NQDPL+ATTGLVPL GIDVW HAYYLQYKN+R
Sbjct: 151 GSGWAWLGYNKKTKLLQIAACPNQDPLEATTGLVPLLGIDVWXHAYYLQYKNLR 204


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 26.6 bits (56), Expect = 1.0
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +3

Query: 222 HHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGG 356
           HH +HHA   ++    +   +   + GD  + + +A AL   GGG
Sbjct: 723 HHHQHHAAPHHHSLQQQHASSAFNSAGDARSGVAVAAALNTGGGG 767


>AY255856-1|AAP13482.1|  248|Anopheles gambiae glutathione
           transferase o1 protein.
          Length = 248

 Score = 24.6 bits (51), Expect = 4.1
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -1

Query: 590 GGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRS 483
           G L+   +  C Y Q +HL + AK  P  A+Y + S
Sbjct: 20  GKLRLYSMRFCPYAQRVHLMLDAKKIPYHAIYINLS 55


>AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative
           5'-nucleotidase protein.
          Length = 570

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +3

Query: 126 VAGASRQKHTLPELPYEYNALEPV 197
           +AG +R  HT+ +L  EY    P+
Sbjct: 65  IAGIARVYHTIKQLKSEYKTKNPL 88


>AJ000034-1|CAA03870.1|   98|Anopheles gambiae 5'-nucleotidase
           protein.
          Length = 98

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +3

Query: 126 VAGASRQKHTLPELPYEYNALEPV 197
           +AG +R  HT+ +L  EY    P+
Sbjct: 65  IAGIARVYHTIKQLKSEYKTKNPL 88


>AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide receptor
           protein.
          Length = 493

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 10/41 (24%), Positives = 21/41 (51%)
 Frame = +1

Query: 292 KLKVISTPLSTLHQP*NSMVVVTSTTRSFGTTCHQMVASLL 414
           K+ ++  PL+ + Q  ++ + +T T   +   CH + A  L
Sbjct: 161 KISLVVYPLAMIAQTASAYLTLTVTLERYVAVCHPLRARAL 201


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 901,628
Number of Sequences: 2352
Number of extensions: 19371
Number of successful extensions: 35
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 35
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95507181
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).