SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    25   2.0  
EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    24   3.6  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   3.6  
AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.    24   3.6  
AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.    24   3.6  
AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.    24   3.6  
AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.    24   3.6  
AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta...    23   6.3  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    23   8.3  

>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +1

Query: 403 NYSLSNSFTLSDHMV 447
           N+ +SN++TLSDH V
Sbjct: 183 NWRVSNAYTLSDHRV 197


>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
           channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +2

Query: 308 ATMGSLYQEHHDEDFFLYIAFSDEN 382
           AT  ++     D+DFF  I+FSD++
Sbjct: 290 ATASAILDTLGDDDFFNLISFSDQS 314


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +1

Query: 355  FIHSIFRRKCLWKLIPNYSLSNSF 426
            F+ S+  R+CL ++ PNY    +F
Sbjct: 1532 FVASVNARQCLIEMKPNYGTFETF 1555


>AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +2

Query: 101 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 190
           KIR +YPDR+       P  ++ D   + Y
Sbjct: 50  KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79


>AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +2

Query: 101 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 190
           KIR +YPDR+       P  ++ D   + Y
Sbjct: 50  KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79


>AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +2

Query: 101 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 190
           KIR +YPDR+       P  ++ D   + Y
Sbjct: 50  KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79


>AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +2

Query: 101 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 190
           KIR +YPDR+       P  ++ D   + Y
Sbjct: 50  KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79


>AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing
            phosphoprotein protein.
          Length = 1200

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -1

Query: 278  RRKVRLQAAGEYVSGSRSRT 219
            R + R Q+AG   SGSRSR+
Sbjct: 1131 RSRSRSQSAGSRKSGSRSRS 1150


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +1

Query: 247  SPAA*RRTFLLREQCHSTHICNNG 318
            +P   R  FL+ E  H  H+CN G
Sbjct: 1110 APIVARAAFLI-ECAHFVHLCNRG 1132


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 642,737
Number of Sequences: 2352
Number of extensions: 12901
Number of successful extensions: 36
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63559560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).