SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z22925-1|CAA80505.1|  211|Anopheles gambiae ANG12 precursor prot...    26   1.5  
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    24   7.8  
AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript...    24   7.8  

>Z22925-1|CAA80505.1|  211|Anopheles gambiae ANG12 precursor
           protein.
          Length = 211

 Score = 26.2 bits (55), Expect = 1.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +3

Query: 159 KIIRWICACLAQLSTSCHRDTVKPLAGSL-----LLCLAEFAVRCGPQYLMEEKDGEQTL 323
           KI  ++ ACL   S      T +PL         LL L +  +    +YL+ +K+ +QTL
Sbjct: 2   KIAAFVVACLVATSAVSCAPTTRPLTDDFDDFVGLLPLNDL-LDLAMRYLLTDKEVQQTL 60

Query: 324 LLL 332
           L L
Sbjct: 61  LYL 63


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
 Frame = +3

Query: 612 PAVLTAPNIQLMRFSDSTLASLIELPALDLPARA-GTTPGLTTSERQVRVLLRD 770
           PA+   P  Q++R S  + A     P+L  P    G  PG+       R+ L +
Sbjct: 392 PAIYLDPRYQMLRASHHSAAGHPLYPSLPYPPNLYGMLPGMGMQSIHERMKLEE 445


>AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1009

 Score = 23.8 bits (49), Expect = 7.8
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = -1

Query: 206 AGRKLGQACADPSNYFSS*SWVHLYNTVSVIG--KH*YAIADDF 81
           +GR       D +N F+S SW+ + N +  I   K+ Y I  D+
Sbjct: 539 SGRYCAVVTLDVTNAFNSASWLAIANALQRINTPKYLYDIIGDY 582


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 998,246
Number of Sequences: 2352
Number of extensions: 20420
Number of successful extensions: 38
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 105016554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).