SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative calcium/c...    23   7.5  
L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase pro...    23   10.0 
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    23   10.0 
AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase p...    23   10.0 

>CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative
           calcium/calmodulin-dependentprotein kinase, CAKI
           protein.
          Length = 872

 Score = 23.4 bits (48), Expect = 7.5
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = -1

Query: 120 SQRAAPPPLLLFIVKRIFYKEMENK 46
           S R+APPP+ +F+  +  Y  ++++
Sbjct: 556 SYRSAPPPVEIFVRAQFDYDPLDDE 580


>L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 10.0
 Identities = 9/31 (29%), Positives = 16/31 (51%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDL 530
           G  HN    F+ + ++ DH  + S  + GD+
Sbjct: 361 GDMHNMGHVFISYAHDPDHRHLESFGVMGDV 391


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 23.0 bits (47), Expect = 10.0
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -2

Query: 518 QEAGERRQRDREEDPVLAPRPARLPHVLP 432
           +EA   R+R+RE +         +PH LP
Sbjct: 519 REAARERERERERERERERMMHMMPHSLP 547


>AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 10.0
 Identities = 9/31 (29%), Positives = 16/31 (51%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDL 530
           G  HN    F+ + ++ DH  + S  + GD+
Sbjct: 361 GDMHNMGHVFISYAHDPDHRHLESFGVMGDV 391


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 514,254
Number of Sequences: 2352
Number of extensions: 9203
Number of successful extensions: 35
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76507752
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).