SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L36067-1|AAA29362.1|  229|Anopheles gambiae polyubiquitin protein.    112   2e-26
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    27   0.77 
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    26   1.3  
Z81291-1|CAB03592.1|  209|Anopheles gambiae GSTD1-5 protein prot...    24   7.1  
AF071160-3|AAC79993.1|  209|Anopheles gambiae glutathione S-tran...    24   7.1  

>L36067-1|AAA29362.1|  229|Anopheles gambiae polyubiquitin protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-26
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-26
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-26
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling
            promoter protein.
          Length = 1197

 Score = 27.1 bits (57), Expect = 0.77
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -3

Query: 341  NNCTSNLCSFCSYEYGNWSAHCQGSFNS 258
            N C++  CS  S  + N S+H   S NS
Sbjct: 1083 NRCSNGSCSSTSSSHSNHSSHSSSSSNS 1110


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 26.2 bits (55), Expect = 1.3
 Identities = 14/46 (30%), Positives = 28/46 (60%)
 Frame = -1

Query: 361 GNFFDEKTIVHRTCAASVLMNMEIGLPTVKEVSILSRAPTLLSQLF 224
           G++F+E+ +++ T A  V  ++  G+P   + SIL   PTL + ++
Sbjct: 615 GSYFEERKLIYNTSAGPVERHISAGVP---QESIL--GPTLWNVMY 655


>Z81291-1|CAB03592.1|  209|Anopheles gambiae GSTD1-5 protein
           protein.
          Length = 209

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
 Frame = -1

Query: 307 LMNMEIGLPTVKEVSILSRAPTLLSQLF-----KFLCIYLLIRFTQQDKIYP 167
           LM  E   P   +++     PTL+   F     + +C YL  ++ + DK+YP
Sbjct: 33  LMKGEHMKPEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYGKDDKLYP 84


>AF071160-3|AAC79993.1|  209|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 209

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
 Frame = -1

Query: 307 LMNMEIGLPTVKEVSILSRAPTLLSQLF-----KFLCIYLLIRFTQQDKIYP 167
           LM  E   P   +++     PTL+   F     + +C YL  ++ + DK+YP
Sbjct: 33  LMKGEHMKPEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYGKDDKLYP 84


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 867,387
Number of Sequences: 2352
Number of extensions: 18092
Number of successful extensions: 54
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95920632
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).