SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         500   e-143
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         500   e-143
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         500   e-143
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          474   e-135
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           30   0.071
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           30   0.071
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           30   0.071
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           30   0.071
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           30   0.071
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    30   0.071
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           28   0.38 
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           28   0.38 
AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.         25   2.0  
AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.7  
AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.7  
AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.7  
AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.7  
X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.             24   6.2  
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         24   6.2  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   6.2  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   8.1  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   8.1  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-143
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-143
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  500 bits (1232), Expect = e-143
 Identities = 237/237 (100%), Positives = 237/237 (100%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 237


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  474 bits (1169), Expect = e-135
 Identities = 220/236 (93%), Positives = 229/236 (97%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETF  PA+YVAIQAVLSLYASGRTTG+VLDSGDGVSHTVPIYEGYALPHAILR+D
Sbjct: 121 TQIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGDGVSHTVPIYEGYALPHAILRMD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM  AA+SSS
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQAAAASSS 236


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 26.2 bits (55), Expect = 1.2
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           T+P+ P +  T   +PP    T  TV   P  +T  TH+PT +  W+
Sbjct: 197 TTPA-PTTTTTWSDLPPPPPTTTTTVWIDPTATTT-THAPTTTTTWS 241



 Score = 25.0 bits (52), Expect = 2.7
 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 1/31 (3%)
 Frame = +2

Query: 512 PVVPPVSCWT-PATVSPTPCPSTKDTHSPTP 601
           P     + WT P   + TP P+T  T S  P
Sbjct: 181 PTTTTTTVWTDPTATTTTPAPTTTTTWSDLP 211



 Score = 24.2 bits (50), Expect = 4.7
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 8/63 (12%)
 Frame = +2

Query: 458 STRPPCTSPSKPC--SRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCVW 613
           +T P  T+ S P   S+ T P +   +  WT  T    P  +T  +  P P     + VW
Sbjct: 130 TTFPTTTTTSAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVW 189

Query: 614 T*P 622
           T P
Sbjct: 190 TDP 192


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 26.2 bits (55), Expect = 1.2
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           T+P+ P +  T   +PP    T  TV   P  +T  TH+PT +  W+
Sbjct: 197 TTPA-PTTTTTWSDLPPPPPTTTTTVWIDPTATTT-THAPTTTTTWS 241



 Score = 25.0 bits (52), Expect = 2.7
 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 1/31 (3%)
 Frame = +2

Query: 512 PVVPPVSCWT-PATVSPTPCPSTKDTHSPTP 601
           P     + WT P   + TP P+T  T S  P
Sbjct: 181 PTTTTTTVWTDPTATTTTPAPTTTTTWSDLP 211



 Score = 24.2 bits (50), Expect = 4.7
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 8/63 (12%)
 Frame = +2

Query: 458 STRPPCTSPSKPC--SRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCVW 613
           +T P  T+ S P   S+ T P +   +  WT  T    P  +T  +  P P     + VW
Sbjct: 130 TTFPTTTTTSAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVW 189

Query: 614 T*P 622
           T P
Sbjct: 190 TDP 192


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +2

Query: 521 PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 213 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 241


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 25.0 bits (52), Expect = 2.7
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 521 PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           PP +  T     PT   +T  TH+PT +  W+
Sbjct: 180 PPTTTTTTVWTDPT---ATTTTHAPTTTTTWS 208



 Score = 24.2 bits (50), Expect = 4.7
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 8/63 (12%)
 Frame = +2

Query: 458 STRPPCTSPSKPC--SRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCVW 613
           +T P  T+ S P   S+ T P +   +  WT  T    P  +T  +  P P     + VW
Sbjct: 130 TTFPTTTTTSAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPRPPTTTTTTVW 189

Query: 614 T*P 622
           T P
Sbjct: 190 TDP 192


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 23.8 bits (49), Expect = 6.2
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 3/56 (5%)
 Frame = +2

Query: 458 STRPPCTSP---SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +T P  T P   S P +  T    P     T  TV  T   +T  TH+PT +  W+
Sbjct: 154 TTTPIWTDPTTWSAPTTTTTWSDQPRPPTTTTTTVW-TDSTATTTTHAPTTTTTWS 208


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 30.3 bits (65), Expect = 0.071
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 4/63 (6%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP----TPCPSTKDTHSPTPSCVW 613
           C   S     T+  +P +   RP     + W   T +     T  P+T  T +PT    W
Sbjct: 88  CESQSPGDQTTTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTKFPTTTTTSAPTTPSQW 147

Query: 614 T*P 622
           T P
Sbjct: 148 TDP 150



 Score = 28.7 bits (61), Expect = 0.22
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 3/56 (5%)
 Frame = +2

Query: 458 STRPPCTSP---SKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           +T P  T P   S P +  T    PP    T  TV   P  +T  TH+PT +  W+
Sbjct: 154 TTTPVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTVWTDPTATTT-THAPTTTTTWS 208



 Score = 26.2 bits (55), Expect = 1.2
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           T+   P +  T   +PP    T  TV   P  +T  TH+PT +  W+
Sbjct: 196 TTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTT-THAPTTTTTWS 241



 Score = 24.6 bits (51), Expect = 3.5
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 6/64 (9%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCV 610
           +K  T    ++P+ P S+ T P +   +  WT  T    P  +T  +  P P     + V
Sbjct: 130 TKFPTTTTTSAPTTP-SQWTDPTITTTTPVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTV 188

Query: 611 WT*P 622
           WT P
Sbjct: 189 WTDP 192


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 27.9 bits (59), Expect = 0.38
 Identities = 17/62 (27%), Positives = 22/62 (35%), Gaps = 3/62 (4%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC---PSTKDTHSPTPSCVWT 616
           C   S     T+  +P +   RP        T  T   T     P+T  T +PT    WT
Sbjct: 88  CEPQSPGDQTTTTLRPATTTLRPTTTTTDWITTTTTEATTTTRFPTTTTTSAPTTPSQWT 147

Query: 617 *P 622
            P
Sbjct: 148 DP 149



 Score = 25.4 bits (53), Expect = 2.0
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +2

Query: 521 PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 212 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 240



 Score = 23.4 bits (48), Expect = 8.1
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 6/64 (9%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCV 610
           ++  T    ++P+ P S+ T P +   +  WT  T    P  +T  +  P P     + V
Sbjct: 129 TRFPTTTTTSAPTTP-SQWTDPTITTTTPVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTV 187

Query: 611 WT*P 622
           WT P
Sbjct: 188 WTDP 191


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 27.9 bits (59), Expect = 0.38
 Identities = 17/62 (27%), Positives = 22/62 (35%), Gaps = 3/62 (4%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC---PSTKDTHSPTPSCVWT 616
           C   S     T+  +P +   RP        T  T   T     P+T  T +PT    WT
Sbjct: 88  CEPQSPGDQTTTTLRPATTTLRPTTTTTDWITTTTTEATTTTRFPTTTTTSAPTTPSQWT 147

Query: 617 *P 622
            P
Sbjct: 148 DP 149



 Score = 23.4 bits (48), Expect = 8.1
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 6/64 (9%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTP-----SCV 610
           ++  T    ++P+ P S+ T P +   +  WT  T    P  +T  +  P P     + V
Sbjct: 129 TRFPTTTTTSAPTTP-SQWTDPTITTTTPVWTDPTTWSAPTTTTTWSDQPPPPTTTTTTV 187

Query: 611 WT*P 622
           WT P
Sbjct: 188 WTDP 191


>AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.
          Length = 187

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 6/40 (15%)
 Frame = +2

Query: 506 TRPVVPPVSCWT-----PATVSPTPCPSTKDT-HSPTPSC 607
           T+  V P S  T     P T +P PCP T  T +   P+C
Sbjct: 117 TKATVAPKSTTTTTTVKPTTTTPPPCPPTLTTFNGGQPTC 156


>AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%)
 Frame = +2

Query: 542 PATVSPTPCPSTKDT-HSPTPSC 607
           P T +P PCP T  T +   P+C
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTC 158


>AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%)
 Frame = +2

Query: 542 PATVSPTPCPSTKDT-HSPTPSC 607
           P T +P PCP T  T +   P+C
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTC 158


>AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%)
 Frame = +2

Query: 542 PATVSPTPCPSTKDT-HSPTPSC 607
           P T +P PCP T  T +   P+C
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTC 158


>AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 25.0 bits (52), Expect = 2.7
 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%)
 Frame = +2

Query: 542 PATVSPTPCPSTKDT-HSPTPSC 607
           P T +P PCP T  T +   P+C
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTC 158


>X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.
          Length = 1231

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +2

Query: 446  CSKHSTRPPCTSPSKPCSRCTRPV 517
            C+KH TR P   P +    C  P+
Sbjct: 987  CNKHKTRVPHILPYESSRVCLTPI 1010


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +3

Query: 408 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRV 512
           Q + QQ+EDD  H +  QH  H     + A +VRV
Sbjct: 641 QQEEQQQEDDHHHHQ--QHHHHHHAEVTTAGSVRV 673


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 183 GKAPPSGRDGRYGTEGL 233
           G+  P GRDG +G  GL
Sbjct: 344 GQPGPRGRDGNFGPVGL 360


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 497 SRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           SRC++P V   +  TPA++S +   S+  + S T  C
Sbjct: 777 SRCSKPSVTSTTPPTPASLSSS--SSSSSSASSTSLC 811


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 8.1
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 70  FKMCDEEVAALVVDNGSGMC 129
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 915,498
Number of Sequences: 2352
Number of extensions: 22126
Number of successful extensions: 118
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 77
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 82744797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).