SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090824-1|BAC57923.1|  298|Anopheles gambiae gag-like protein p...    25   3.8  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    24   6.6  
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    23   8.7  
AF000953-1|AAB96576.1|  433|Anopheles gambiae carboxypeptidase A...    23   8.7  

>AB090824-1|BAC57923.1|  298|Anopheles gambiae gag-like protein
           protein.
          Length = 298

 Score = 24.6 bits (51), Expect = 3.8
 Identities = 17/54 (31%), Positives = 24/54 (44%)
 Frame = -3

Query: 655 RCKRWVCRSSPI*RGSQTTRTSWCTRCGCS*LGSRRPF*PD*FCIRCSCPRRMA 494
           RC R + R   +     T R+S C RCG +   +      D  C+ C  P R+A
Sbjct: 235 RCFRCLERGHMVRECQGTNRSSLCIRCGAANHKAVNCT-NDVKCLLCGGPHRIA 287


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 23.8 bits (49), Expect = 6.6
 Identities = 19/62 (30%), Positives = 26/62 (41%)
 Frame = -3

Query: 679 PLLRQSLCRCKRWVCRSSPI*RGSQTTRTSWCTRCGCS*LGSRRPF*PD*FCIRCSCPRR 500
           P  +QS  RC R + R       +   R+S C  CG +   +      D  CI C  P R
Sbjct: 282 PKQQQSAVRCFRCLERGHTTADCAGEDRSSLCLHCGAADHRAASCT-SDPKCIVCGGPHR 340

Query: 499 MA 494
           +A
Sbjct: 341 IA 342


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = -1

Query: 399  FEVGDEVHVHHLLVVYNGEAVLN 331
            F + ++ H  H+LV Y    +LN
Sbjct: 2065 FGIDEKKHAQHVLVDYKSHQILN 2087


>AF000953-1|AAB96576.1|  433|Anopheles gambiae carboxypeptidase A
           protein.
          Length = 433

 Score = 23.4 bits (48), Expect = 8.7
 Identities = 13/39 (33%), Positives = 19/39 (48%)
 Frame = +1

Query: 430 LAQHALRWEEDYVPHEVIRIVEPSYVGMNNEYRISLAKK 546
           LA      E DY+PHE   ++E +     +E R+ L  K
Sbjct: 85  LADFTETLESDYIPHE---LIEQNVQRAFDEERVRLTNK 120


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 908,798
Number of Sequences: 2352
Number of extensions: 18743
Number of successful extensions: 44
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 41
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 88478514
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).