SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    31   0.070
AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    25   3.5  
AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.            25   3.5  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          24   6.1  
AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.           24   8.0  

>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 30.7 bits (66), Expect = 0.070
 Identities = 21/94 (22%), Positives = 45/94 (47%)
 Frame = +2

Query: 629 SLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEI 808
           ++DS+  +L+++   D+L  +       TP L +P++++ +R     + S+   T     
Sbjct: 117 TIDSSLSSLRSAIKSDLLAEILALADKLTPVLAKPSVSQPSRTHTSTNASSLNATNTRTT 176

Query: 809 RDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           +   TR T     S+E T ++ +  ++ N V  S
Sbjct: 177 KTASTRRTF--TNSMELTADIQQAANDTNTVEAS 208


>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 25.0 bits (52), Expect = 3.5
 Identities = 12/47 (25%), Positives = 23/47 (48%)
 Frame = +2

Query: 230  ESTPPIVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHD 370
            E +P I+  +QP E P D N   +   ++  +++ + F    + Y D
Sbjct: 1477 EESPGILSDDQPPESPCDSNDSDETTKNLPWLKSVSNFLGSFNYYCD 1523


>AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.
          Length = 1152

 Score = 25.0 bits (52), Expect = 3.5
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = +2

Query: 665  ATEDILTTLPTEPVVQTPPLQEPAI 739
            AT   LTT PTEP+    P   P +
Sbjct: 1083 ATPPALTTPPTEPISSATPAPGPFV 1107


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 24.2 bits (50), Expect = 6.1
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +3

Query: 687 PYLQNQLSKPHPYRSQPSTRQPEGHPRMTCL 779
           PY   + S+P  Y + P+T  P+  P  T L
Sbjct: 832 PYHAREDSRPFTYGNIPATGTPQQPPAATML 862


>AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.
          Length = 165

 Score = 23.8 bits (49), Expect = 8.0
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +3

Query: 372 PNANISFQWPKNLNQHQPL 428
           PN +I+F  P   N HQ L
Sbjct: 3   PNGSIAFMLPTGANPHQTL 21


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 880,425
Number of Sequences: 2352
Number of extensions: 18005
Number of successful extensions: 68
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68
length of database: 563,979
effective HSP length: 65
effective length of database: 411,099
effective search space used: 107707938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).