SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    24   4.1  
AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ...    23   7.2  
AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450 CY...    23   9.5  
AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein p...    23   9.5  

>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
           channel alpha subunitprotein.
          Length = 2139

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -1

Query: 187 LGCRHPHYAAHQGMNLYRVHNCLI 116
           LG RH  Y +HQ    Y  H  L+
Sbjct: 630 LGSRHSSYTSHQSRISYTSHGDLL 653


>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
           chain protein.
          Length = 1024

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 19/71 (26%), Positives = 24/71 (33%), Gaps = 1/71 (1%)
 Frame = -3

Query: 377 GNRGLGACSDMTS-KGGEALPSILLVXXXXXXXXXXXXRQQHSNDRKKPPVPLDFFPPKG 201
           G  G+     M   KG   LP +  +              Q    RK PP P  F  PKG
Sbjct: 669 GLEGVAGLPGMVGEKGDRGLPGMSGLNGAPGEKGQKGETPQLPPQRKGPPGPPGFNGPKG 728

Query: 200 VDPETGVPSPS 168
                G+  P+
Sbjct: 729 DKGLPGLAGPA 739


>AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450
           CYP9L1 protein protein.
          Length = 533

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = -3

Query: 251 NDRKKPPVPLDFFPPKGVDPETGVPS 174
           ND  K  +PL  + P G+ P   + S
Sbjct: 453 NDENKHKIPLGAYLPFGIGPRNCIAS 478


>AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein
           protein.
          Length = 357

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 19/63 (30%), Positives = 26/63 (41%)
 Frame = -2

Query: 345 DQQGRRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPRNWGAVTLI 166
           ++Q R +  V      A+  S A   APT Q  S  AAG +     ++ R R   A T  
Sbjct: 45  NRQNRFANVVQVKATYANTVS-AKTVAPTPQAASHTAAGNSGQKKKKKSRSRFLSAATPA 103

Query: 165 MLH 157
             H
Sbjct: 104 PTH 106


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 785,739
Number of Sequences: 2352
Number of extensions: 17784
Number of successful extensions: 63
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).