SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    26   1.2  
U03849-1|AAA53488.1|  388|Anopheles gambiae putative nucleic aci...    25   3.7  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    24   4.9  
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    24   6.5  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   8.6  
AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.    23   8.6  

>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 26.2 bits (55), Expect = 1.2
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -1

Query: 817 GDLFSCSKAGGAGGGT 770
           G    C+KAGG GGGT
Sbjct: 191 GGTNGCTKAGGGGGGT 206


>U03849-1|AAA53488.1|  388|Anopheles gambiae putative nucleic acid
           binding protein protein.
          Length = 388

 Score = 24.6 bits (51), Expect = 3.7
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = -3

Query: 248 ARKPKSQTEHKSTGLRTNLIEIGSTPH*PWPDRIYIKKIHFRRPIL 111
           A +P     H+  G       + + P  P+ DRI+I+   ++RP L
Sbjct: 176 AVQPAPTQPHELVGTDPLSSPLQAAPREPFTDRIWIRLSAYQRPSL 221


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase
            protein.
          Length = 1344

 Score = 24.2 bits (50), Expect = 4.9
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 817  GDLFSCSKAGGAGGGTPV 764
            GD+FS    GG G G P+
Sbjct: 1277 GDIFSMKTPGGGGYGVPL 1294


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
            differentiation regulator protein.
          Length = 1283

 Score = 23.8 bits (49), Expect = 6.5
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = +3

Query: 657  PSAHSGATATSCRTTAEEVC*SAYSKSNPWQVRGGST------GVP-PPAPPALEQEKRS 815
            P++++GA   +  T A     +  SK     V+G +        +P PPAPP  ++++R+
Sbjct: 1167 PNSNAGAATPTATTAAPLAPTTGNSKGGGGVVQGDTATALDEVALPAPPAPPTSKRDRRT 1226


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 756 GGSTGVPPPAPP 791
           GG  G PPP PP
Sbjct: 525 GGPLGPPPPPPP 536


>AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.
          Length = 1376

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = +3

Query: 753 RGGSTGVPPPAPPALEQEKRSP 818
           R G   +PPP PP    E + P
Sbjct: 47  RIGGIYIPPPVPPYCSTECKGP 68


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 816,759
Number of Sequences: 2352
Number of extensions: 16029
Number of successful extensions: 46
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 87318630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).