SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    29   0.20 
AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2 pro...    27   0.82 
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    27   0.82 
AY748841-1|AAV28189.1|  158|Anopheles gambiae cytochrome P450 pr...    25   2.5  
AY745222-1|AAU93489.1|  276|Anopheles gambiae cytochrome P450 pr...    24   7.6  
AM085517-1|CAJ30215.1|  339|Anopheles gambiae putative angiotens...    24   7.6  
AJ302661-1|CAC35526.1|  128|Anopheles gambiae gSG8 protein protein.    24   7.6  

>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 29.1 bits (62), Expect = 0.20
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
 Frame = +1

Query: 295 TSKSKLSADAKEWYPANYT--SQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDM 468
           TS+   S     +YP++    SQ +PA      P +PSRP++    +Q   + P    D 
Sbjct: 355 TSRPVASGPTSHYYPSHIPAGSQPVPAVVN---PQQPSRPTIPAPQQQTPPRQPPATGDR 411

Query: 469 SYSLEEAENMD 501
           + +  + E +D
Sbjct: 412 APAHPDVEQID 422


>AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2
           protein.
          Length = 755

 Score = 27.1 bits (57), Expect = 0.82
 Identities = 15/49 (30%), Positives = 18/49 (36%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 450
           S+L  D +  Y         P  NT    Y+   PSV G      D NP
Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1
           protein.
          Length = 2051

 Score = 27.1 bits (57), Expect = 0.82
 Identities = 15/49 (30%), Positives = 18/49 (36%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNP 450
           S+L  D +  Y         P  NT    Y+   PSV G      D NP
Sbjct: 157 SQLQLDTQGAYVIKSEFNQFPENNTLTGVYKTMEPSVTGECETLYDVNP 205


>AY748841-1|AAV28189.1|  158|Anopheles gambiae cytochrome P450
           protein.
          Length = 158

 Score = 25.4 bits (53), Expect = 2.5
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +1

Query: 343 NYTSQALPAYNTEPAPYRPSRPSVQGRL 426
           NY     PA   EP  +RP R   QGRL
Sbjct: 126 NYDLSMSPALWDEPERFRPERFLQQGRL 153


>AY745222-1|AAU93489.1|  276|Anopheles gambiae cytochrome P450
           protein.
          Length = 276

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 10/29 (34%), Positives = 13/29 (44%)
 Frame = +1

Query: 364 PAYNTEPAPYRPSRPSVQGRLRQAQDQNP 450
           PAY  +P  Y P R +   +L  A    P
Sbjct: 191 PAYYPQPDVYNPDRFAASSKLSGASKNRP 219


>AM085517-1|CAJ30215.1|  339|Anopheles gambiae putative angiotensin
           converting enzymeprecursor protein.
          Length = 339

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +1

Query: 370 YNTEPAPYRPSRPSVQGR 423
           YN    PY P+ PS  GR
Sbjct: 199 YNPNARPYNPNDPSFGGR 216


>AJ302661-1|CAC35526.1|  128|Anopheles gambiae gSG8 protein protein.
          Length = 128

 Score = 23.8 bits (49), Expect = 7.6
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -3

Query: 259 AGARVPGCSFATPGLVLL 206
           AG R P C +  P LVL+
Sbjct: 88  AGLRQPACRYRVPSLVLV 105


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,033,393
Number of Sequences: 2352
Number of extensions: 22482
Number of successful extensions: 47
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 46
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 102535848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).