SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    38   2e-04
AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript...    38   3e-04
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    34   0.003
AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript...    33   0.007
M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           33   0.009
AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript...    32   0.012
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    31   0.021
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    31   0.021
AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    31   0.027
AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    29   0.084
AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    29   0.11 
M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    27   0.59 
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    26   0.78 
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    26   0.78 
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    25   1.4  
CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.          25   1.8  
AF515522-1|AAM61889.1|  222|Anopheles gambiae glutathione S-tran...    25   1.8  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            24   4.2  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   5.5  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    23   7.3  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   7.3  
M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles ...    23   9.6  
CR954256-10|CAJ14151.1|  548|Anopheles gambiae putative alkaline...    23   9.6  
AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR prot...    23   9.6  
AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ...    23   9.6  

>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 37.9 bits (84), Expect = 2e-04
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVV-GPDEPTHIPTAAQLQPDVLDV 259
           ++ GD NA H  WGSR N+  G  LL+  +    S++     PT I   A  +P V+DV
Sbjct: 119 VIAGDFNAWHTEWGSRRNNLRGEELLQMVEVLGLSILNNGSAPTFIGRGA-ARPSVIDV 176


>AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 37.5 bits (83), Expect = 3e-04
 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +2

Query: 95  GDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGP-DEPTHIPTAAQLQPDVLDVC 262
           GD NA H  WGS  NS  G  LL+        V+   +EPT I   A     V+DVC
Sbjct: 142 GDFNAWHTEWGSARNSQRGEDLLQLIQSVQLQVINSGNEPTFIGRGAATS-SVIDVC 197


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 34.3 bits (75), Expect = 0.003
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVV 196
           ++ GD NA HV WGS  NS  G  LL    + D  V+
Sbjct: 120 VIAGDFNAWHVEWGSERNSEKGEELLSAIQQLDLVVL 156


>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1222

 Score = 33.1 bits (72), Expect = 0.007
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGP-DEPTHIPTAAQLQPDVLDV 259
           +  GDLNA H AWGS   +A G  +++  D     V+     PT +      +P V+DV
Sbjct: 117 VFAGDLNAWHTAWGSCRTNAKGEAVVQLVDSLGLEVLNTGTAPTFLGNGV-ARPSVVDV 174


>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 32.7 bits (71), Expect = 0.009
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +2

Query: 62  LNCDSRPALLV-GDLNAKHVAWGSRLNSAVGRRLLE 166
           L   S P ++V GD NA H  WGSR ++  G  LLE
Sbjct: 167 LEAQSHPQVVVAGDFNAWHEEWGSRRSNERGEVLLE 202


>AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1168

 Score = 32.3 bits (70), Expect = 0.012
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDAD 175
           LL GD NA H+ WGS      G  LL+ AD
Sbjct: 118 LLAGDFNAMHLDWGSSRTCPKGLELLQLAD 147


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 31.5 bits (68), Expect = 0.021
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 71  DSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADR 178
           D  P ++ GD NA    WGS+  +A G  +LE   R
Sbjct: 111 DVNPIIISGDFNAWATEWGSKSTNARGNAVLEHFSR 146


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 31.5 bits (68), Expect = 0.021
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 77  RPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADR 178
           RP ++ GD NA  V WGS+  ++ G  +LE   R
Sbjct: 111 RPLVIAGDFNAWAVEWGSKRTNSRGDAVLESFAR 144


>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 31.1 bits (67), Expect = 0.027
 Identities = 14/27 (51%), Positives = 15/27 (55%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLE 166
           LL GD NA H AWGS      G  LL+
Sbjct: 117 LLAGDFNAWHTAWGSERTKPKGIALLQ 143


>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 29.5 bits (63), Expect = 0.084
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD-EPTHI 220
           ++ GD NA H  WGS  N   G  LL+  +    S++    +PT I
Sbjct: 182 VVAGDFNAWHEEWGSGRNGQRGIELLQTVETLGLSILNQGRKPTFI 227


>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 29.1 bits (62), Expect = 0.11
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADR 178
           +L GD NA H AWGS      G  LL   ++
Sbjct: 117 VLGGDFNAWHEAWGSARTKRKGEELLNTVEQ 147


>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 1222

 Score = 26.6 bits (56), Expect = 0.59
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%)
 Frame = +2

Query: 74  SRPALLV-GDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD-EPTHIPTAAQLQPD 247
           S P ++V GD NA+H  WGS      G  L    ++    V+    E T +     L P 
Sbjct: 125 SHPQVVVAGDFNARHEEWGSPRTCDRGEELHGMVEQLGLIVINQGREYTFVGNGVAL-PS 183

Query: 248 VLDV 259
           ++DV
Sbjct: 184 IVDV 187


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 26.2 bits (55), Expect = 0.78
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +2

Query: 38  HPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTH 217
           HP D R+ LNC++  A  V D      A+   + +    R + D D+ +  +V  D PT 
Sbjct: 300 HPTDCRKFLNCNN-GARFVQDC-GPGTAFNPLILTCDHLRNV-DCDKSENVIVDYDRPTS 356

Query: 218 IPTAA 232
            P A+
Sbjct: 357 RPVAS 361


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 26.2 bits (55), Expect = 0.78
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +2

Query: 38  HPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTH 217
           HP D R+ LNC++  A  V D      A+   + +    R + D D+ +  +V  D PT 
Sbjct: 299 HPTDCRKFLNCNN-GARFVQDC-GPGTAFNPLILTCDHLRNV-DCDKSENVIVDYDRPTS 355

Query: 218 IPTAA 232
            P A+
Sbjct: 356 RPVAS 360


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
            polyprotein protein.
          Length = 1726

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 9/24 (37%), Positives = 16/24 (66%)
 Frame = +2

Query: 377  PLRPKVDWELFKRRLVDLPAIQDP 448
            P + + +WE+F+R+L  L  +Q P
Sbjct: 1010 PQQMRQEWEVFERQLTHLQEVQVP 1033


>CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.
          Length = 659

 Score = 25.0 bits (52), Expect = 1.8
 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = -2

Query: 308 RTVPQ*LRGTVAPYERTHPTRRA-GVARRSECA-WVRRGRPQSSRPYRH 168
           RT+P       A        RRA   ARR  C    RR  P ++RP RH
Sbjct: 475 RTIPPTRVAAAAAAPEGRRRRRAIARARRRRCRPRARRNPPATTRPVRH 523


>AF515522-1|AAM61889.1|  222|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 222

 Score = 25.0 bits (52), Expect = 1.8
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = -3

Query: 415 SLKELPVDLRS*GRGRNPGEPHSQCDQDREMGGTQVVQCL 296
           +LKE+P D++     ++ GE H  C++ RE+   + V  L
Sbjct: 31  NLKEIPYDIKPISLIKSGGEQH--CNEYREVNPMEQVPAL 68


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.8 bits (49), Expect = 4.2
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%)
 Frame = +3

Query: 333  SW--SHWEWGSPGLRPRPYDRRSTGSSLRDA 419
            SW  S W+W  PG     +    TG+SL +A
Sbjct: 2779 SWDPSKWDWSQPGTWNALFIGSLTGASLFNA 2809


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 23.4 bits (48), Expect = 5.5
 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = -2

Query: 284 GTVAPYERTHPTRRAGVARRSECAWVRRGRPQSSRPYRHL--LTAACPL 144
           GT  P     PTRRAGV            +PQ  RP R L  LT   PL
Sbjct: 66  GTTIPIAPKKPTRRAGV------------KPQPDRPMRALFCLTRTNPL 102


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 14/32 (43%), Positives = 14/32 (43%)
 Frame = +1

Query: 307 RPGYPPSPYPGHTGNGAHPGCDLAPTTEGRLG 402
           R G P   YPG  G    PG   AP   GR G
Sbjct: 152 RDGLPG--YPGIPGTNGVPGVPGAPGLAGRDG 181


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +3

Query: 480 SALSTPSGERSTRRRLLCPAAGPEVYSR 563
           SAL++P+  R+  R    P  GP +  R
Sbjct: 370 SALNSPNPARAPPRNFTMPGPGPGIGER 397


>M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 574

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 1/23 (4%)
 Frame = +1

Query: 61  PEL-RQPPSSAGRGPQREARRVG 126
           PEL R+P SS  R P R  R  G
Sbjct: 2   PELKRKPTSSCSRSPARRRRIQG 24


>CR954256-10|CAJ14151.1|  548|Anopheles gambiae putative alkaline
           phosphatase protein.
          Length = 548

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%)
 Frame = +2

Query: 458 EGVDDAAVRLVDS--IRGAIDQATTLVPSGGPRGILPAH 568
           +G D A  + + S  I G + +   ++  GG R  LP H
Sbjct: 240 DGFDPAVCQDIASQLIHGEVGKHMQVIMGGGRREFLPTH 278


>AY391745-1|AAR28995.1|  460|Anopheles gambiae putative GPCR
           protein.
          Length = 460

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 269 YERTHPTRRAGVARRS 222
           Y  THP  R G+ RRS
Sbjct: 260 YFSTHPNGRNGILRRS 275


>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
           chain protein.
          Length = 1024

 Score = 22.6 bits (46), Expect = 9.6
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +1

Query: 511 RPGDDSCAQRRAQRYTPGP 567
           RPG+D     + QR  PGP
Sbjct: 607 RPGNDGLPGPQGQRGLPGP 625


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 700,835
Number of Sequences: 2352
Number of extensions: 15084
Number of successful extensions: 69
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 55927431
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).