SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0005
         (881 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY263176-1|AAP78791.1|  705|Anopheles gambiae TmcB-like protein ...    25   3.1  

>AY263176-1|AAP78791.1|  705|Anopheles gambiae TmcB-like protein
           protein.
          Length = 705

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 362 QTIKFFGQLGSNLLLHLIIYISLFIYYGLNCHIDPLC 252
           QT+ +FG L +  LL L+    L ++Y   C +  LC
Sbjct: 469 QTLLWFGVLFAPPLLLLVALKLLLVFYVNKCELMYLC 505


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 855,904
Number of Sequences: 2352
Number of extensions: 16821
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 67
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94680279
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).